SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011922 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011922
Domain Number 1 Region: 535-598,848-968
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.75e-43
Family Ypt/Rab-GAP domain of gyp1p 0.0065
Further Details:      
 
Domain Number 2 Region: 8-198
Classification Level Classification E-value
Superfamily RUN domain-like 6.28e-33
Family RUN domain 0.00064
Further Details:      
 
Domain Number 3 Region: 944-1066
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 3.92e-27
Family Ypt/Rab-GAP domain of gyp1p 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011922   Gene: ENSTNIG00000009063   Transcript: ENSTNIT00000012112
Sequence length 1074
Comment pep:known_by_projection chromosome:TETRAODON8:4:2056200:2063331:-1 gene:ENSTNIG00000009063 transcript:ENSTNIT00000012112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFPVTEAETRQKLLRNVKKEVKQIMEEAVTRKFVHADSSHIISFCAVVEACVLHGLKRR
IAGLLCSNKVAALFMKVAKSFTPAEELCRKVQELEQLIENSKHNNSLGNERVRQSKLANL
PPQAMKHLWIRTALMEKLLDKIVLYLVENSSVFYEREAMLMDPVDGPILASLLVGPCALE
YTKVKTADHFWTDPSADELVQRHRIHSGHCRQDSPSRRPALVQIQKRQSSGSMDDRPLMW
AKEYVESLHQNSRAALLFGKNNVLVQPMQRDDMEAIPGYLSLHQTAELITLKWTPNQLMN
GNVGELDSEKSVYWDYAMTIRLEEIVYLHCHQQVNSGGTVVLVSQDGIQRPPLHFPKGGH
LLQFLTCLETGLLPHGQLDPPLWNQRGKGKVFPKLRKRSPHGSCDSVSDKEDDEATDYVF
RILFPGNQMEYMALELIEQGVNTWQPTPRKSSCSSCSQNGSSDGSLPNGCNQERAPLKLL
CDTMKYQIISRAFYGWLAYCRHLSTVRTHLSALVNTTIVDPDVPCDARGGLSLEVWQKVL
KDSSAYEEKEIYRLVYFGGVDCSLRKEVWPFLLGHYQFNMTEERRLQIDQQMQAAYEQTV
RDWRGCEAIVRQREREKHAEALARCSSGASVERGPVQRGSTISTDSSLSSSSEQQNIHSQ
SDSSSAQVFESVEVVPPTSDASQPGAPPEGGTSTGDAPQLLSCRQPSLGLSDGSKSSPLP
AEAAADSAEASNDSMKAAGGEEILEQHKKEISGSRAETKQPQPIVQHTAESDDSPSALEM
EDIPMGITEKMASEDLVCDRHLDTDCHTSPEGTDLGLSEDEPEMENVLAGAESAEMGGDV
KRECSEEQVYSQETLDMYLINLHRIDKDVRRCDRQYWYFTSENLEKLRNIMCSYVWQHLD
TGYVQGMCDLLAPLLVILDDEVMAFSCFTELMKRMNQNFPHGGAMDSHFANMRSLIQILD
SELFELMQQNGDYTHFYFCYRWFLLDFKREMVYDDVFSLWETIWAAKHTSSEHFVLFVAL
ALVEMYRDIILENNMDFTDIIKFFNEMAERHNVPQVLMMARDLVHKVQTLIENK
Download sequence
Identical sequences H3CUI8
ENSTNIP00000011922 99883.ENSTNIP00000011922 ENSTNIP00000011922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]