SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011958 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011958
Domain Number 1 Region: 40-221
Classification Level Classification E-value
Superfamily vWA-like 1.46e-37
Family Integrin A (or I) domain 0.00000304
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011958   Gene: ENSTNIG00000009099   Transcript: ENSTNIT00000012148
Sequence length 571
Comment pep:known_by_projection chromosome:TETRAODON8:4:1738314:1745304:1 gene:ENSTNIG00000009099 transcript:ENSTNIT00000012148 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQCCCRQVLLGVEVSIVVMALVAGGAGQTHDSRAAGSSCYGGFDLYFVLDKSGSVQHYW
NEIFYFVHHLAHKFISPQMRMSFIVFSTDGRTLMALTEDRDKIRAGLEELRMVQPGGDTY
MDRGLHRASEQIYYAAGDGYRAASVIIALTDGELREDQFDTAQREAGRARQLGASVYCVG
LKDFNETQLSTIADSKDHVFPVHDGFEALQSVIDSILKRSCIEILAVQPSSICEGESFQV
VVKGNGFLHARDVQKVLCSFRVNDTLTLMKRPLVVRDTYLLCPAPLLEREGTSATLHVSM
NNGLSFISSSVTIEAVACSDGTFVAVALLILMLLLTLVLLWWFWPLCCTVVVHEPPPPVA
EDDSDDEEGLPKKKWPTVDASYYGGRGVGGIKRMEVRWGDKGSTEEGAKLEKAKNARVVM
PTEEESLARPYHAAHKPVRSHKWYSPIKGKLDALCVFLRKGYDRVSIMRPLPGDKGKCIN
FTRSRSYPVTRYPVYRPPPTPIYTLPPSPTSKLPPLPSLHPSSCATLPVYSRHPDLFSAP
PSPTGSLPPPPQAPPLCRAPPPSRPPPRPNN
Download sequence
Identical sequences H3CUM4
ENSTNIP00000011958 ENSTNIP00000011958 99883.ENSTNIP00000011958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]