SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011974 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011974
Domain Number 1 Region: 5-109
Classification Level Classification E-value
Superfamily PX domain 5.36e-22
Family PX domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011974   Gene: ENSTNIG00000009115   Transcript: ENSTNIT00000012164
Sequence length 172
Comment pep:novel chromosome:TETRAODON8:4:1625408:1627537:-1 gene:ENSTNIG00000009115 transcript:ENSTNIT00000012164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPVSVSIPSFRSENSPVEKGFTVFRIDVLVNGRQHAVEKRYSEFHTLHKMLKKSIKPPE
MPSKHVRNWVPKVLEQRRQGLELYLQTVIAENRVLPRIFLDFLSIRHFPSVPKTESCGSF
DTESQGSSKLSHQPVLLFLRDPYLLPSAHDLFSNVVIEGVVHGVFYPHLHPR
Download sequence
Identical sequences Q4SJ80
ENSTNIP00000011974 ENSTNIP00000011974 99883.ENSTNIP00000011974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]