SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011989 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011989
Domain Number 1 Region: 17-238
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.79e-55
Family Ankyrin repeat 0.00024
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011989
Domain Number - Region: 355-388
Classification Level Classification E-value
Superfamily BLRF2-like 0.0209
Family BLRF2-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011989   Gene: ENSTNIG00000009129   Transcript: ENSTNIT00000012179
Sequence length 931
Comment pep:known_by_projection chromosome:TETRAODON8:4:1420394:1433371:-1 gene:ENSTNIG00000009129 transcript:ENSTNIT00000012179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSLKAKFRKTDVNEWNKNDERLLAAVEHGEAEKLASLLSKKGSSAAKLDNDGKSALHVA
AARGQSDCLAVLLAHSADLTVSDAAGLAPLHLAARNNHLECCRKLLQSKSPVDAADVSGR
TALHHAASGGNTQVVQLLCEFRSPVNLKDADGLTPLLCSAKHGHADACAALLDCGADIDA
RDNAGRTALMLASESNALAAVEVLIQRGADLSSLDSQGHDVGHYAKLSGSPEIQTALNRR
SSDSKSHRSPQSTPQHDQVAKLSDERITTPKKRKAPPPPLSPQQSSGPASPPAAVSTQTP
PSSKNDTPENFACKVKRAEILQQGRQRNSSFPVFHQADLLVSLLLQTPASAALVSALQAR
IAALTLENQQLADKLKKHPTADEDLKESSRPNSMTSNSSFHSTQDELDVLAAACDEAEDA
SDRRVEGESGGGGREEVGLLRQALESVQLKLLETRKENRWLQAHCTPSAPERGTSLSGKL
TDTQERYHQAVEEVEELRAQAGGEGRETAEKQDQVQRCTRLEQEVAQLRARLVQEGSRAD
AFWVIETPQSGLCGPAAPLSVRLVQEALRGTVPVEAAARDFEEMKAELNQVISGLQRRLL
ELSHSYSETRSQLSAAEKQLVQAPAPPSEGPQVEELQAEAERLRRLLADAEKEKAAAQEE
TLLLRQEAEAQAQSWVALSDHTQVVSSLGNAIKEAERQAEALKEDLHQKTLQVETLQDRL
AAASHVAPADAVPRAEHEGVREQLAAEVSRLTQLLQGALRKQDEMALDAADAWQKAREDG
AQREALQELVASREQEKQALGSRLAEAQDAVCQLKQLVENHVASEREKNKRIDDLSREVA
KLKEALNSLSQLSYSAGSPSKRQQQNQQLETLQAQVKHLQYQLAETKKQHQEIVSVYRMH
LLYAVQGQMDEDVQKALKQILMMCKMSGQAE
Download sequence
Identical sequences H3CUQ5
99883.ENSTNIP00000011989 ENSTNIP00000011989 ENSTNIP00000011989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]