SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012002 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012002
Domain Number 1 Region: 35-130
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.76e-35
Family Platelet-derived growth factor-like 0.0001
Further Details:      
 
Domain Number 2 Region: 139-193
Classification Level Classification E-value
Superfamily Heparin-binding domain from vascular endothelial growth factor 5.75e-23
Family Heparin-binding domain from vascular endothelial growth factor 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012002   Gene: ENSTNIG00000009142   Transcript: ENSTNIT00000012192
Sequence length 193
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:91478398:91486662:1 gene:ENSTNIG00000009142 transcript:ENSTNIT00000012192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISYTMNFIDSLTLLFLTLSAVKNAHIPKGTERGPHDVIPLMEVYNKSLCRPRELLIEILQ
EYPEEVEHLFLPSCVVLRRCAGCCTDEMLQCTPTATYNVTMQIKRIKFRGQENNFLMSFT
EHSACECRVKPDVNKPDDKKCGPCCDHCSEKRKRLFVQDPVTCRCSCKHTDEHCKDRQLE
LNERTCKCDKPRR
Download sequence
Identical sequences H3CUR8
99883.ENSTNIP00000012002 ENSTNIP00000012002 ENSTNIP00000012002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]