SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012027 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012027
Domain Number 1 Region: 32-152
Classification Level Classification E-value
Superfamily Second domain of FERM 5.63e-42
Family Second domain of FERM 0.00000146
Further Details:      
 
Domain Number 2 Region: 153-261
Classification Level Classification E-value
Superfamily PH domain-like 6.52e-37
Family Third domain of FERM 0.00000504
Further Details:      
 
Domain Number 3 Region: 1-29
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000496
Family First domain of FERM 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012027   Gene: ENSTNIG00000009166   Transcript: ENSTNIT00000012217
Sequence length 284
Comment pep:known_by_projection chromosome:TETRAODON8:21:1822216:1828517:1 gene:ENSTNIG00000009166 transcript:ENSTNIT00000012217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVSHVREKYEQARPSEEWRYELRIRYLPKAFVQQFTEDKPTLSYFYHQVKNDYMMEIGD
QVDQDVALKLGCLEIRRFFKEMRGNALDKKSNYELLEKDVGLRRFFPKALLDSVKAKTLR
KLIQQTFKQVANLNDEQCILKFLEILAPICRYDKECFKCALGSSWVIQVELAIGPEEGIS
YLTDKGSTPTHLANFNQVQSIQYSAMEEKDRKGMIQLNVAGAAEPLTVTTASLTTAENLA
DLIDGYCRLISMESHSFIVRVHKEGERALPSIPKMIPKCAQSLK
Download sequence
Identical sequences H3CUU3
ENSTNIP00000012027 99883.ENSTNIP00000012027 ENSTNIP00000012027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]