SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012047 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012047
Domain Number 1 Region: 557-661
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-32
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 2 Region: 720-835
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-32
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 3 Region: 1778-1887
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.49e-31
Family Spermadhesin, CUB domain 0.00043
Further Details:      
 
Domain Number 4 Region: 178-280
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.88e-31
Family Spermadhesin, CUB domain 0.00083
Further Details:      
 
Domain Number 5 Region: 2116-2235
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-31
Family Spermadhesin, CUB domain 0.00083
Further Details:      
 
Domain Number 6 Region: 1950-2058
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-30
Family Spermadhesin, CUB domain 0.0007
Further Details:      
 
Domain Number 7 Region: 1-107
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-29
Family Spermadhesin, CUB domain 0.00044
Further Details:      
 
Domain Number 8 Region: 1243-1359
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-29
Family Spermadhesin, CUB domain 0.00057
Further Details:      
 
Domain Number 9 Region: 2304-2407
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.03e-28
Family Spermadhesin, CUB domain 0.00079
Further Details:      
 
Domain Number 10 Region: 381-490
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.1e-27
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 11 Region: 1425-1534
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-26
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 12 Region: 1075-1185
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-24
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 13 Region: 899-1009
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-23
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 14 Region: 1594-1707
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.58e-21
Family Spermadhesin, CUB domain 0.0054
Further Details:      
 
Domain Number 15 Region: 3012-3083
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.35e-20
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 16 Region: 3072-3141
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.72e-19
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 17 Region: 2656-2724
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.89e-18
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 18 Region: 2772-2845
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-17
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 19 Region: 2896-2964
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.53e-17
Family Complement control module/SCR domain 0.00089
Further Details:      
 
Domain Number 20 Region: 2713-2781
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.9e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 21 Region: 2597-2666
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.5e-16
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 22 Region: 2828-2889
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.21e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 23 Region: 2954-3017
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000106
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 24 Region: 2063-2131
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000634
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 25 Region: 318-389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000139
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 26 Region: 3192-3260
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 27 Region: 2408-2481
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000032
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 28 Region: 1363-1429
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000378
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 29 Region: 1717-1782
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000473
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 30 Region: 1891-1953
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000756
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 31 Region: 1539-1604
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000089
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 32 Region: 841-901
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000222
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 33 Region: 113-177
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000264
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 34 Region: 1017-1079
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000058
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 35 Region: 666-735
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000625
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 36 Region: 1189-1251
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000702
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 37 Region: 3124-3186
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000104
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 38 Region: 3252-3310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000222
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 39 Region: 2542-2603
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000324
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 40 Region: 2472-2536
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000417
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 41 Region: 496-557
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000431
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 42 Region: 2234-2299
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000202
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012047   Gene: ENSTNIG00000009187   Transcript: ENSTNIT00000012238
Sequence length 3553
Comment pep:known_by_projection chromosome:TETRAODON8:21:2139219:2288099:-1 gene:ENSTNIG00000009187 transcript:ENSTNIT00000012238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGGALKGRNGSIESPGFPYGYPNGANCTWVIVGEEGSRIQLIFLSFAIEEEYDFLSLYDG
HPHPANFRTRLTGFQVPPPVTSTGNVFSLRLTSDFAVSAHGFKLNYEELHSTSCGNPGVP
PKAVLSGSGRFAVGDQVQYSCVPGYVLDGHATLTCITNAGNTAVWDFPAPICRAEDTCGG
TVRGGSGVVTSPGYPGNYGNQADCTWILMAEPGDTISVVFTDFQTEEKYDYLEVEGSEPP
TIWLSGSNVPSPIISNKNWLRLHFVTDNNHRYRGFSAHYQVKRSVDFKSRGVKLFPGKDS
SNKFSLLNEGGVRQASNSCPDPGEPENGKRHGSDFSIGGVVQFSCGEDYVLQGSKTISCQ
RVAEVFAAWSDHRPVCKVKTCGSNLQGPSGTFTSPNFPIQYESNAQCVWIITASNPNKVI
QINFEEFDLEIAYDTLTIGDGGEVGDPTTILQVLSGSFVPDLIVSMTHQMWLHLQSDESV
GSIGFKINYKGMTKKSCGDPGTPLYGREGENFSNGGILRFECQFGFELIGERTISCQDNN
QWSANIPICIFPCMSNFTAPSGTVLSPDYPEGYGNNMNCVWFIQSEPGSRIHLAFNDFDL
EAPYDSLTVKDGETNDALVIGRFTGAESPSHLTSNTNTLRLEFQADHSMSGRGFNITYST
FGHNECPDPGIPINARRFGDSFQLGSSISVVCEDGFIKTQGSETISCQLERGKVMWSGPI
PKCEAPCGGHYSAPSGVILSPGWPGYYKDSLSCEWVIESEPGRSIKITFDKFQTELGYDI
LEIHDGPNLLSPLIGSFNGTQVPQFLFSSSNFLYLLFITDNSRSNVGFKILYESVTVDSY
SCLDPGIPVNGIRYGQDFSIGSTVSFGCDSGYRLSHEEPLVCEKNHWWSHPLPTCDALCG
GDVRGPWGTILSPGYPDSYPSSLNCTWTVEVSHGKAGVQFQFNSFHLEDQHDYLLVTENG
SFLQPLARLTGNELPGNINAGLYGNFKAQLRFISDFSISYEGFNITFSATEYTLEPCEDP
GMPRFGRRNGYSFGIGDTLTFSCNLGYRLEGAPELICLGGGRRMWSAPLPRCVAECGSSV
MNNEGILLSPNYPMNYDNNHECIYSIQVQAGKGINISARTFHLAQGDILKVIYDGKDNTA
HILGAFTGSSMLGLTLISTSNHLWLEFYSDPENTGEGFKLVYSSFELSHCEDPGVPQFGL
KVNDQGHFAGSSITYRCEPGYTLHGASTLKCMTGERRAWDNPLPSCIAECGGRFKGESSG
RILSPGYPFPYDNNLRCTWTIEVDSGNIVSLQFLSFDTEASHDMLKVWDGPPENEMSLAE
LSGSLLPEGIHSTLNTVTVQFETDFYISKSGFAIQFSSSVATACRDPGVPMNGSRSGDGR
EPGDSVSFQCDPGYELQGDDKITCIQVDNRYYWQPSPPVCIVVAPCGGNLTGSSGFILSP
NYPHPYPHSKDCDWLIAVNSDYVLSLAFIGLNIDRPFVAFIVCYYPXDSNSRLIGSFQDS
KLPERIESSSNTLYLAFRSDGSVSYTGFHLEYKAKLRESCFDPGVVLNGTRLGSDYKLGS
TITFYCEAGYVLQGYSTLTCSMGDDGRPGWNRALPSCQAPCGSRSTGSEGTVLSPNFPKN
YTSGQMCVYSISVQREFVLFGQFVLFQTSLNDVVEIYDGPTQQNTLLSSLSGSHSGESLP
LSTGNQITIKFTTVGPETAKGFHFVYQGSVPRTSSTQCSSVPEPRFGKRLGNDFAVGSLV
QFECNPGYVLHGSTAIRCESVPDNLAQWNDTLPTCLVPCGGVLTSRRGTILSPGYPEPYN
NNQNCVWKVSVPEGAGIQIQVVSFATEHNWDSLDFYDGADNHASRLGSYSGTTIPPLLNS
TSNNLYLSFSSDISVSAAGFHLEYTAIGLESCPEPQTPNYGIRQGDRFMVGDVVQYSCEQ
GYSLQGNAYITCMPGPVRRWNYPVPLCLAQCGGSMTDVSGVILSPGYPGNYPSGLDCTWT
VNLPIDFGIHIQFLNFSTEAIHDYLEIRSGTLETGSVIDRYSGPFIPKPLFSTTHQTSFF
FHSDYSQNKPGFHITFQAYQLQSCPDPRPFRNGIVIGTDFSVGMTVSFECQPGYSLIGEA
SLTCLHGISRNWNHPLPRCEAFCGGNVTSLNGTIYSPGYPEEYPNFQDCVWSVRVPPGHG
IYINFTVLSIEHIYDYITVWDGPDQSSPQIGQFSGNTALESVYSTSNIILIKFHSDFSGA
GFFVLSYHAYQLRVCQPPPEVSNADMLMEDGELEIGDIIRYKCHPGFSLVGSEILTCRLG
ERLQMDSPPPVCQVQCPAHEVRYDSSGVILSPGWPESYPNLQMCSWSVIVEKGYNVTITF
ESFHTEREFDVLEIFDGPTANSPTLATLSGDLPTPFNLTTSGHQFLVRWSSDHGTNKSGF
KIRYVALYCSTPDSPLHGSISSQSGGHINSVVRWACDRGYHLIGNTTAACRRTPLGYHAW
DSPIPACQAVSCGAPQAPINGARSHLITLVGTRVSYFCNDGYKLSSKELTSAICQPDGRW
SNHNKIPRCSVVVCPSIGSFSLEHGRWRIVNGSHYEYRTRIVFTCDPGYFRLGPAHIQCL
PNGTWSWKNERPRCQIISCSELPSPPNGIKIGTQTTFGATAIFTCDPGFMLVGSHVRECL
SSGLWSGTETRCLAGHCGIPEGIVNGQVIGENFGYRDTVVYQCLPGFRLIGSSVRICLQD
NQWSGQLPVCTPISCGHPGSPIYGRTVGNGFNLNDVVSFVCNQGYEMEGPTHAQCQANRQ
WSHPPPTCKVVVNCSDPGIPANSIRQSKIEYGNFTFGTVVFFDCNPGFYLFGSPVLTCQP
TGQWDKPLPECIVVDCGHPGSPPNGVLSGDKFTFGSTVRYSCLGGRQLKGESSRTCQLNG
MWSTPMPFCSGNHPNYCIDPGIPSHGSREQTDFKIRSKVYFSCSEGFDLIGSSERMCFPN
GTWSGTQPFCKPVQCGNPGTPSNGRVFRLDGTTFSHSVVYSCMDGYLLNGATTRQCLANG
TWSGAQPNCTMINCGDPGLPANGLRYGEDFTISQNVTFQCQPGYRMEEDGSSVRTCTQNG
TWSGNMPLCTAVTCPPPPAISNGALQGSDFEWGSSVSYSCSPGYELSFPAVLTCVANGTW
SGMLPQCLPKFCGDPGTPVSGFREGRSFIYQSEVSFSCTPPLILVGTATRLCESDGTWSG
KQPRCIEPTKTSCDNPGTPRYGSLNRTSASRVVGSVVSFQCQPGHLIQGSSSRTCQPDLT
WSGTQPECIPHACKQPESPLHVDVAGMDLPGYGYTLVYSCQPGYFLAGGSEHRVCKSDGT
WTGKMPVCRAGEKKKAVKPVTGTPSPKLNDDVFAPNYIWKGSYNYRGRKQPMTLSITSFN
STTGRVNVSLSNGNMELLLSGVYKASEARLLLLMYQVNYVNQGNKLKDAAITPAKIIEDS
WTMDGFVSAEPNGSSYVFQGFIQGKDYGQFGLQRLGLNMSESQNSPPPQLGTNSSSVAIA
ILVPFFALIFTGFGFYLYKQRTTPKTQYTGCSVHENNNGQAAFENPMYNTNAKAVEGKAV
RFDPNLNTVCTMV
Download sequence
Identical sequences H3CUW3
ENSTNIP00000012047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]