SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012082 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012082
Domain Number 1 Region: 246-460
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.07e-83
Family Fibrinogen C-terminal domain-like 0.00000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012082   Gene: ENSTNIG00000009219   Transcript: ENSTNIT00000012273
Sequence length 463
Comment pep:known_by_projection chromosome:TETRAODON8:21:3652947:3664085:1 gene:ENSTNIG00000009219 transcript:ENSTNIT00000012273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQQHRVQHGPCSYTFILPEVNHCQPLNDLKVSNTFQRDSPQASTDEQKLESLESAMENNT
QWLQKLENFIQENVRSGMEEMKRTAVHTQTAAMLEMGTNLLTQSAEQTRKLTNVETQVLN
QTSRLEIQVLEYSLLTNRLEKHILQQTQEISRLGDKNSFLEQRLSALEARYGKELQELES
EKEQLQKLVERQSQTVSQLQAEVGSSMHNSTLMQRQQAMLMNTVQQLLATVNNCKEISSV
ASGDLLTFRDCAEILQSGVTDSGVYTIRLPNSTQTVKVFCDMKTGGGGWTVLQHRRNGSV
DFHRGWRDYKMGFGELSGEHWLGNDIIHKLTTSKDYSLHILLKDREGNEAFSNYDRFYIN
GEENNYSLYTENYSGTAGRMSSLAHSGTQFSTKDRDNDRCTCRCAQLASGGWWFEACGPS
NLNGIYYSSSTSTMRYNDIKWYYWKGSKLMAAMTTMMVRPTNF
Download sequence
Identical sequences H3CUZ8
99883.ENSTNIP00000012082 ENSTNIP00000012082 ENSTNIP00000012082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]