SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012083 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012083
Domain Number 1 Region: 1433-1541
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 734-848
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-33
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 3 Region: 1253-1374
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-30
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 4 Region: 2-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-30
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 5 Region: 566-675
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-30
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 6 Region: 394-504
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-30
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 
Domain Number 7 Region: 1956-2068
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 8 Region: 1086-1195
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 906-1027
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-25
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 10 Region: 2131-2238
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-25
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 11 Region: 1607-1717
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-22
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 12 Region: 2300-2419
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-21
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 13 Region: 3022-3093
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.23e-19
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 14 Region: 2666-2732
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 15 Region: 3082-3151
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.89e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 2906-2973
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 17 Region: 2723-2791
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 18 Region: 2418-2491
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.02e-16
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 19 Region: 3202-3268
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000612
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 20 Region: 2783-2851
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000998
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 21 Region: 2963-3027
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 22 Region: 1825-1898
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000017
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 23 Region: 2607-2670
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 24 Region: 1373-1439
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000917
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 25 Region: 1897-1959
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000108
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 26 Region: 1198-1264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 27 Region: 1546-1612
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000202
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 28 Region: 2073-2141
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000378
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 29 Region: 680-750
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 30 Region: 2481-2547
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000553
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 31 Region: 3140-3197
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000057
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 32 Region: 509-574
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000057
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 33 Region: 1727-1787
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000089
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 34 Region: 2844-2900
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000138
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 35 Region: 327-403
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000011
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 36 Region: 2243-2307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000113
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 37 Region: 1027-1096
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000119
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 38 Region: 3261-3319
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000347
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 39 Region: 188-290
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000055
Family Spermadhesin, CUB domain 0.0039
Further Details:      
 
Domain Number 40 Region: 855-914
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000089
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 41 Region: 2543-2618
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000101
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012083   Gene: ENSTNIG00000009220   Transcript: ENSTNIT00000012274
Sequence length 3559
Comment pep:known_by_projection chromosome:TETRAODON8:21:3735752:3860623:-1 gene:ENSTNIG00000009220 transcript:ENSTNIT00000012274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNCSYTLHAPNGTIESPGYPYGYPNYANCTWVIVAAEHNRIQLVFQGFALEEDFDILSVY
DGTPSPGNLRTRLTGFQLPSPIVSTGSRLTLWLLSDYAVSGQGFKVNYEAIPRRTAGEKA
SVIKFAIIDSRSNFKEKHALFCCLLGYLLEIACSAHSTRSSVLDPGNCSRGNFLGFFCYS
ERQLNILLRGFSSIIRQPPPLSVYYDNVSSCCWTVCSQPGLINTDVYLRKRIEKRMNIEE
IKGTKEKGPQAKFTGPNLPSPIISSKNWLRLHFTSDGNHKLRGFSAQYQVKKMTELKSRG
VKMLPSKDNQHKISVLSQMGVVQGHNMCPDPGIPDRGKRKGSDFSWISRRGATVHFSCDE
GYELQGSKSISCLRVTDSYVGWSDDRPICRAPMCGGQLRGPNGVITSPNYPVQYDNNANC
TWIITATDTSKVIKLTFEDFDLERGYDTLTVGDGEVVGDQKTIFHVLSGTTTPDLVVSTS
HQMWLNFKTDDTSGSLGFRVSYEEIEQGSCGDPGVPSYGKREGTGFRHGDRLYFECLPAF
ELVGKKNITCQKNNQWSAKKPSCVFSCFFNFTTPSGVLLSPNYPQEYGNNMHCVWLIISN
PESRINLAFNDLSMEKQFDFLSIKDGGKAESPILGTFSGDVLPPSITTSGHVARLEFLTD
HTYTDRGFNITFTTFRHNECPDPGVPVNGKRFGENLQLGSSISFLCEEGFVKTHGSQTIS
CILKDGNVVWDNAVPRCEAPCGGHLKAPNGIILSPGWPELYKEALNCEWIIEAPPGYPIK
IIFDKFRTEVNYDVLEVHDGRFPSSPLIGSYQGTQVPQFLISTSNFLYLLFSTDKSHSDI
GFRIRYETLQLQSDHCVDPGIPVNGQRHGNDFYVGACTFSCEAGYTLSDKEPLECEPNFQ
WSRPLPSCDALCGGYIHGSLGTILSPGFPDFYPHNLNCTWVIETSHGKGVQFTFHTFHLE
SPHDHLLVTENGSFSQPLWRLTGSTLPPPLSAGLFGNYTAQIRFLSDFSVSYEGFNITFS
EYDLEPCEDPGIPSYSTRKGLQYGVGDALIFSCFPGYRLEGPARLICLGGRRRVWSSPLP
RCVVAECGSSVTGMQGVLLSPNYPGYYGNNHECIYSIQTQPGKGIQLRARDFRLEEDDLL
RVFDGSSNKARLLGVFTGSELLDTTLNSTSNSMWLEFISNADNTSKGFELHFISFELVKC
EDPGVPQFGYKREDRGHFAGSTVSFSCDPGYMLKGPEVLTCLRGERRSWDSPLPLCVAEC
GGTIKNEPSGRILSPGYPAPYEHNLHCIWTIEAPPGSTISLHFLVFHTEEVHDVLRIWDG
PNDGGVLLRELSGSALPQDAHSTFNTITLQFTTDFFTSKQGFALQFSVSTATSCNDPGMP
TNGTRSGDSREPGDHVVFQCDPGYILQGAKRIVCTEISGRYFWQPDPPTCTAPCGGNLTG
PSGMILSPDYPEPYPHGRECDWTVTVTPDYVIALSFNQFSLEPSYDFLHIYDGPDSLSPL
LGSFYGTDVPDRIESSSNTLFLAFRSDASLSSNGFVLQYTENPRESCFEPGGIRNGTRVG
VELKLGSTITYRCDSGYTLEGDPTLTCIMGGDGKPSWNKAKPICIAPCGGQYTGLEGVVL
SPGYPGNYSRAQTCLYSVVVPKDYVVFSQFAFFHTALNDIVEVYDGATQHSRVLSSLSGA
HTDAAGESLPLATSNQILIRFTSKSQSSSRGFHLAYQEAVPQTSATQCSSVPEPRNGRRM
GNNFAVGAVIRFECSPGYILEGSSAIECLTVPNALAQWNSSIPSCIGQKSGFNRLRGWPS
SEGRTSGWAEDLQKYFKLLLSLSKIQVISFVTEQNWDSLEVFDGGDNTDTMLGSFSGTTV
PALLNSTSNQLYLHFFSDISVSAAGFRLEYKTVSLTSCPEPVVPMNGIKVGERLQMNNVV
SFLCEPGYTLQGMSHITCMPGTVRRWNYPPPLCIAQCGGIREEMEGMILSPGFPGNYPSN
SDCTWRIYLPVGYVFRGCHIQFLNFSTEANHDFLEIRNGPLDTSTMIGRFSGQDVPSSLL
TTSHETTIYFHSDHSQNKPGFRFEYQAYELQECPDPEPFRYGAVVGAGFNVGQSISFECL
PGYQLSGHSILTCEHGTTRNWDHPFPHCEAPCGGNITLDNGTIFSPRYPEEYPNSADCSW
LITVAPGFGVKVNFTLLQVHGPHDFITVWDGPQETARKLGIFTDGEPNEPPSSTSNQVLI
RFRSNTEKGGLFRIDYQAYRLQFCQPPPIIPNAEILMASKEFKIGDIVRYRCLPGYHLSG
NSILTCRLGTHLEFEGPPPSCDVTCPMNELLTASTGVIMSQSPGNGFPHFESCSWVVKVE
PGYNITFTIEHFQTSRQFDELEIFDGPSRQSPLLITLSGNYSSPLSITSSINKVYLHWSF
DHTTSHKGFRIRYSVAAYCSPPSFPINGSVHSLTGTKLGSTLRFSCDQGFRLIGQSSATC
TRTPQGIHQWNAPVPLCQVMSCGMPVPPVNGSIVGQDFSLGARSAYQCNPGFRLAGPVTN
SVICQESGRWSTTEALPRCIPVTCPDIGHSAVEHGRWRLIYGTQNQYDAIMMLVCDPGYY
YRGQRIIRCQVNGTWNYPDPRPVCDIISCRDLGTPPNGNKIGTLTVFGATAIFSCNTGYT
LVGSRVRECMSNGLWSGTQVQCLAGHCGTPEPIVNGQIIGENYNYRGSVVYQCNPGFRLI
GVSVRICEQDHHWSGLTPICVPITCGHPGNPIFGMTQGTQFNLNDNVRFVCNTGYVLHGA
VKSICQANGQWSNALPKCRIVNCTEPGHIENSIRQVLSSGPHRYSFQTAVSYRCNPGYYL
LGTSSISCQGDGTWDRSLPKCLLVLCDRPSVPPYAQISGDRRTVGSVIRYSCISQRTIIG
NTTRMCQLDGQWSGSPPHCSGDSAGLCGDPGVPVHGIRLGEEFSVGSIVYFSCEPGYTLK
GSPERSCLANETWLGTQPECHVISCGNPGTPRNAQILVHDGLTFSKSITYTCREGYYSTG
LLTRHCTVNGTWTGNVPECSVINCGDPGVPANGVRLGNDFTYNHTVTFQCSPGFTMDADR
ASTLICTKDRTWNGTKPLCKAIVCGPPLSIPNGQVVGTEFTWGSSISYSCNQGYQLSLPT
VLTCQGSGNWSGEKPQCFPVFCGDPGVPAQGRREDRGFTYLSSVSFFCYAPYILVGSARR
YCQYDGIWSGTQPSCIDPTHTSCGDPGTPLFGNQNNTQGYQVGNTVFFSCRKGYLLQGSI
SRTCMPNLTWSGFQPECIAHHCSQPELPAQSDVRAIELPSLGYTLIYTCQPGFYLAGGSE
HRTCRSDGSWTGKPPLCAADNRPSGKSPVGTVQEPPSKLPVPGGVFAKNSLWRGSYEYLG
KKQPAMLNITAFEPFSNRVNGTLIDHSGVELKLAGTYKREEAQLLLQVHQIRGPVEIFVN
KFKIDNWALDGHVSYISSSNSFVYQGFVRGKGFGQFGLQRLESLISFRDNQGYNFASNSS
SVAAAILVPFIAMIIAGFALYLYKHRRRPKVPFNGYVGHENTNGRATFENPMYDRNIQPT
DIMAGENFYLFIHLVCLCF
Download sequence
Identical sequences H3CUZ9
ENSTNIP00000012083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]