SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012084 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012084
Domain Number 1 Region: 1434-1542
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 735-849
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-33
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 3 Region: 1254-1375
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-30
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 4 Region: 2-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-30
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 5 Region: 567-676
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-30
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 6 Region: 395-505
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-30
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 
Domain Number 7 Region: 1957-2069
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 8 Region: 1087-1196
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 907-1028
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-25
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 10 Region: 2132-2239
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-25
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 11 Region: 1608-1718
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-22
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 12 Region: 2301-2420
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-21
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 13 Region: 3023-3094
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.23e-19
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 14 Region: 2667-2733
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 15 Region: 3083-3152
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.89e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 2907-2974
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 17 Region: 2724-2792
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 18 Region: 2419-2492
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.02e-16
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 19 Region: 3203-3269
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000612
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 20 Region: 2784-2852
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000998
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 21 Region: 2964-3028
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 22 Region: 1826-1899
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000017
Family Spermadhesin, CUB domain 0.0031
Further Details:      
 
Domain Number 23 Region: 2608-2671
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 24 Region: 1374-1440
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000959
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 25 Region: 1898-1960
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000108
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 26 Region: 1199-1265
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 27 Region: 1547-1613
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000202
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 28 Region: 2074-2142
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000378
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 29 Region: 681-751
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 30 Region: 2482-2548
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000553
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 31 Region: 3141-3198
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000057
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 32 Region: 510-575
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000057
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 33 Region: 1728-1788
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000089
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 34 Region: 2845-2901
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000138
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 35 Region: 328-404
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000011
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 36 Region: 2244-2308
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000113
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 37 Region: 1028-1097
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000119
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 38 Region: 3262-3320
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000347
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 39 Region: 856-915
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000089
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 40 Region: 2544-2619
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000101
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 41 Region: 208-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000288
Family Spermadhesin, CUB domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012084   Gene: ENSTNIG00000009220   Transcript: ENSTNIT00000012275
Sequence length 3560
Comment pep:known_by_projection chromosome:TETRAODON8:21:3735752:3860623:-1 gene:ENSTNIG00000009220 transcript:ENSTNIT00000012275 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNCSYTLHAPNGTIESPGYPYGYPNYANCTWVIVAAEHNRIQLVFQGFALEEDFDILSVY
DGTPSPGNLRTRLTGFQLPSPIVSTGSRLTLWLLSDYAVSGQGFKVNYEAIPRRTAGEKA
SVIKFAIIDSRSNFKEKHALFCCLLGYLLEIACSAHSTRSSVLDPGNCSRAHMFICHLCD
EKWTRPDSMCLTSGTTVVVHIKSSFKGNIDICTYVIIEEPSKNMAFICIAYCLRKTFKHY
NQAGTKVQSSKLKFTGPNLPSPIISSKNWLRLHFTSDGNHKLRGFSAQYQVKKMTELKSR
GVKMLPSKDNQHKISVLSQMGVVQGHNMCPDPGIPDRGKRKGSDFSWISRRGATVHFSCD
EGYELQGSKSISCLRVTDSYVGWSDDRPICRAPMCGGQLRGPNGVITSPNYPVQYDNNAN
CTWIITATDTSKVIKLTFEDFDLERGYDTLTVGDGEVVGDQKTIFHVLSGTTTPDLVVST
SHQMWLNFKTDDTSGSLGFRVSYEEIEQGSCGDPGVPSYGKREGTGFRHGDRLYFECLPA
FELVGKKNITCQKNNQWSAKKPSCVFSCFFNFTTPSGVLLSPNYPQEYGNNMHCVWLIIS
NPESRINLAFNDLSMEKQFDFLSIKDGGKAESPILGTFSGDVLPPSITTSGHVARLEFLT
DHTYTDRGFNITFTTFRHNECPDPGVPVNGKRFGENLQLGSSISFLCEEGFVKTHGSQTI
SCILKDGNVVWDNAVPRCEAPCGGHLKAPNGIILSPGWPELYKEALNCEWIIEAPPGYPI
KIIFDKFRTEVNYDVLEVHDGRFPSSPLIGSYQGTQVPQFLISTSNFLYLLFSTDKSHSD
IGFRIRYETLQLQSDHCVDPGIPVNGQRHGNDFYVGACTFSCEAGYTLSDKEPLECEPNF
QWSRPLPSCDALCGGYIHGSLGTILSPGFPDFYPHNLNCTWVIETSHGKGVQFTFHTFHL
ESPHDHLLVTENGSFSQPLWRLTGSTLPPPLSAGLFGNYTAQIRFLSDFSVSYEGFNITF
SEYDLEPCEDPGIPSYSTRKGLQYGVGDALIFSCFPGYRLEGPARLICLGGRRRVWSSPL
PRCVVAECGSSVTGMQGVLLSPNYPGYYGNNHECIYSIQTQPGKGIQLRARDFRLEEDDL
LRVFDGSSNKARLLGVFTGSELLDTTLNSTSNSMWLEFISNADNTSKGFELHFISFELVK
CEDPGVPQFGYKREDRGHFAGSTVSFSCDPGYMLKGPEVLTCLRGERRSWDSPLPLCVAE
CGGTIKNEPSGRILSPGYPAPYEHNLHCIWTIEAPPGSTISLHFLVFHTEEVHDVLRIWD
GPNDGGVLLRELSGSALPQDAHSTFNTITLQFTTDFFTSKQGFALQFSVSTATSCNDPGM
PTNGTRSGDSREPGDHVVFQCDPGYILQGAKRIVCTEISGRYFWQPDPPTCTAPCGGNLT
GPSGMILSPDYPEPYPHGRECDWTVTVTPDYVIALSFNQFSLEPSYDFLHIYDGPDSLSP
LLGSFYGTDVPDRIESSSNTLFLAFRSDASLSSNGFVLQYTENPRESCFEPGGIRNGTRV
GVELKLGSTITYRCDSGYTLEGDPTLTCIMGGDGKPSWNKAKPICIAPCGGQYTGLEGVV
LSPGYPGNYSRAQTCLYSVVVPKDYVVFSQFAFFHTALNDIVEVYDGATQHSRVLSSLSG
AHTDAAGESLPLATSNQILIRFTSKSQSSSRGFHLAYQEAVPQTSATQCSSVPEPRNGRR
MGNNFAVGAVIRFECSPGYILEGSSAIECLTVPNALAQWNSSIPSCIGQKSGFNRLRGWP
SSEGRTSGWAEDLQKYFKLLLSLSKIQVISFVTEQNWDSLEVFDGGDNTDTMLGSFSGTT
VPALLNSTSNQLYLHFFSDISVSAAGFRLEYKTVSLTSCPEPVVPMNGIKVGERLQMNNV
VSFLCEPGYTLQGMSHITCMPGTVRRWNYPPPLCIAQCGGIREEMEGMILSPGFPGNYPS
NSDCTWRIYLPVGYVFRGCHIQFLNFSTEANHDFLEIRNGPLDTSTMIGRFSGQDVPSSL
LTTSHETTIYFHSDHSQNKPGFRFEYQAYELQECPDPEPFRYGAVVGAGFNVGQSISFEC
LPGYQLSGHSILTCEHGTTRNWDHPFPHCEAPCGGNITLDNGTIFSPRYPEEYPNSADCS
WLITVAPGFGVKVNFTLLQVHGPHDFITVWDGPQETARKLGIFTDGEPNEPPSSTSNQVL
IRFRSNTEKGGLFRIDYQAYRLQFCQPPPIIPNAEILMASKEFKIGDIVRYRCLPGYHLS
GNSILTCRLGTHLEFEGPPPSCDVTCPMNELLTASTGVIMSQSPGNGFPHFESCSWVVKV
EPGYNITFTIEHFQTSRQFDELEIFDGPSRQSPLLITLSGNYSSPLSITSSINKVYLHWS
FDHTTSHKGFRIRYSVAAYCSPPSFPINGSVHSLTGTKLGSTLRFSCDQGFRLIGQSSAT
CTRTPQGIHQWNAPVPLCQVMSCGMPVPPVNGSIVGQDFSLGARSAYQCNPGFRLAGPVT
NSVICQESGRWSTTEALPRCIPVTCPDIGHSAVEHGRWRLIYGTQNQYDAIMMLVCDPGY
YYRGQRIIRCQVNGTWNYPDPRPVCDIISCRDLGTPPNGNKIGTLTVFGATAIFSCNTGY
TLVGSRVRECMSNGLWSGTQVQCLAGHCGTPEPIVNGQIIGENYNYRGSVVYQCNPGFRL
IGVSVRICEQDHHWSGLTPICVPITCGHPGNPIFGMTQGTQFNLNDNVRFVCNTGYVLHG
AVKSICQANGQWSNALPKCRIVNCTEPGHIENSIRQVLSSGPHRYSFQTAVSYRCNPGYY
LLGTSSISCQGDGTWDRSLPKCLLVLCDRPSVPPYAQISGDRRTVGSVIRYSCISQRTII
GNTTRMCQLDGQWSGSPPHCSGDSAGLCGDPGVPVHGIRLGEEFSVGSIVYFSCEPGYTL
KGSPERSCLANETWLGTQPECHVISCGNPGTPRNAQILVHDGLTFSKSITYTCREGYYST
GLLTRHCTVNGTWTGNVPECSVINCGDPGVPANGVRLGNDFTYNHTVTFQCSPGFTMDAD
RASTLICTKDRTWNGTKPLCKAIVCGPPLSIPNGQVVGTEFTWGSSISYSCNQGYQLSLP
TVLTCQGSGNWSGEKPQCFPVFCGDPGVPAQGRREDRGFTYLSSVSFFCYAPYILVGSAR
RYCQYDGIWSGTQPSCIDPTHTSCGDPGTPLFGNQNNTQGYQVGNTVFFSCRKGYLLQGS
ISRTCMPNLTWSGFQPECIAHHCSQPELPAQSDVRAIELPSLGYTLIYTCQPGFYLAGGS
EHRTCRSDGSWTGKPPLCAADNRPSGKSPVGTVQEPPSKLPVPGGVFAKNSLWRGSYEYL
GKKQPAMLNITAFEPFSNRVNGTLIDHSGVELKLAGTYKREEAQLLLQVHQIRGPVEIFV
NKFKIDNWALDGHVSYISSSNSFVYQGFVRGKGFGQFGLQRLESLISFRDNQGYNFASNS
SSVAAAILVPFIAMIIAGFALYLYKHRRRPKVPFNGYVGHENTNGRATFENPMYDRNIQP
TDIMAGENFYLFIHLVCLCF
Download sequence
Identical sequences H3CV00
ENSTNIP00000012084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]