SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012085 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012085
Domain Number 1 Region: 1432-1540
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.15e-35
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 733-847
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.55e-33
Family Spermadhesin, CUB domain 0.00067
Further Details:      
 
Domain Number 3 Region: 1252-1373
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-30
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 4 Region: 2-111
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-30
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 5 Region: 565-674
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-30
Family Spermadhesin, CUB domain 0.00064
Further Details:      
 
Domain Number 6 Region: 393-503
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-30
Family Spermadhesin, CUB domain 0.00074
Further Details:      
 
Domain Number 7 Region: 1960-2072
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-28
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 8 Region: 1085-1194
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-28
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 9 Region: 905-1026
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.01e-25
Family Spermadhesin, CUB domain 0.0025
Further Details:      
 
Domain Number 10 Region: 2135-2242
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-25
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 11 Region: 1606-1716
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-22
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 
Domain Number 12 Region: 2304-2423
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.11e-21
Family Spermadhesin, CUB domain 0.0019
Further Details:      
 
Domain Number 13 Region: 3026-3097
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.23e-19
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 14 Region: 2670-2736
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.62e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 15 Region: 3086-3155
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.89e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 16 Region: 2910-2977
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.95e-17
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 17 Region: 2727-2795
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 18 Region: 2422-2495
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.02e-16
Family Complement control module/SCR domain 0.00073
Further Details:      
 
Domain Number 19 Region: 1804-1902
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.07e-16
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 20 Region: 3206-3272
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000612
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 21 Region: 2787-2855
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000998
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 22 Region: 2967-3031
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000153
Family Complement control module/SCR domain 0.00099
Further Details:      
 
Domain Number 23 Region: 2611-2674
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000222
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 24 Region: 1372-1438
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000959
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 25 Region: 1901-1963
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000108
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 26 Region: 1197-1263
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000138
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 27 Region: 1545-1611
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000202
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 28 Region: 2077-2145
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000389
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 29 Region: 679-749
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000459
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 30 Region: 2485-2551
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000553
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 31 Region: 3144-3201
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000057
Family Complement control module/SCR domain 0.00095
Further Details:      
 
Domain Number 32 Region: 508-573
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000057
Family Complement control module/SCR domain 0.00086
Further Details:      
 
Domain Number 33 Region: 1726-1786
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000101
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 34 Region: 2848-2904
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000138
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 35 Region: 326-402
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000011
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 36 Region: 2247-2311
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000113
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 37 Region: 1026-1095
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000119
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 38 Region: 3265-3323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000347
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 39 Region: 854-913
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000089
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 40 Region: 2547-2622
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000089
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 41 Region: 189-289
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000641
Family Spermadhesin, CUB domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012085   Gene: ENSTNIG00000009220   Transcript: ENSTNIT00000012276
Sequence length 3563
Comment pep:known_by_projection chromosome:TETRAODON8:21:3735752:3860623:-1 gene:ENSTNIG00000009220 transcript:ENSTNIT00000012276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNCSYTLHAPNGTIESPGYPYGYPNYANCTWVIVAAEHNRIQLVFQGFALEEDFDILSVY
DGTPSPGNLRTRLTGFQLPSPIVSTGSRLTLWLLSDYAVSGQGFKVNYEAIPRRTAGEKA
SVIKFAIIDSRSNFKEKHALFCCLLGYLLEIACSAHSTRSSVLDPGNCSRGNFLGFFCYS
ERQLNILLRGFSSILQVPFFKRERERVSSCCWTVCSQPGLINTDVYLRKRIEKRMNIEEI
KGTKEKGPQAKFTGPNLPSPIISSKNWLRLHFTSDGNHKLRGFSAQYQVKKMTELKSRGV
KMLPSKDNQHKISVLSQMGVVQGHNMCPDPGIPDRGKRKGSDFSWISRRGATVHFSCDEG
YELQGSKSISCLRVTDSYVGWSDDRPICRAPMCGGQLRGPNGVITSPNYPVQYDNNANCT
WIITATDTSKVIKLTFEDFDLERGYDTLTVGDGEVVGDQKTIFHVLSGTTTPDLVVSTSH
QMWLNFKTDDTSGSLGFRVSYEEIEQGSCGDPGVPSYGKREGTGFRHGDRLYFECLPAFE
LVGKKNITCQKNNQWSAKKPSCVFSCFFNFTTPSGVLLSPNYPQEYGNNMHCVWLIISNP
ESRINLAFNDLSMEKQFDFLSIKDGGKAESPILGTFSGDVLPPSITTSGHVARLEFLTDH
TYTDRGFNITFTTFRHNECPDPGVPVNGKRFGENLQLGSSISFLCEEGFVKTHGSQTISC
ILKDGNVVWDNAVPRCEAPCGGHLKAPNGIILSPGWPELYKEALNCEWIIEAPPGYPIKI
IFDKFRTEVNYDVLEVHDGRFPSSPLIGSYQGTQVPQFLISTSNFLYLLFSTDKSHSDIG
FRIRYETLQLQSDHCVDPGIPVNGQRHGNDFYVGACTFSCEAGYTLSDKEPLECEPNFQW
SRPLPSCDALCGGYIHGSLGTILSPGFPDFYPHNLNCTWVIETSHGKGVQFTFHTFHLES
PHDHLLVTENGSFSQPLWRLTGSTLPPPLSAGLFGNYTAQIRFLSDFSVSYEGFNITFSE
YDLEPCEDPGIPSYSTRKGLQYGVGDALIFSCFPGYRLEGPARLICLGGRRRVWSSPLPR
CVVAECGSSVTGMQGVLLSPNYPGYYGNNHECIYSIQTQPGKGIQLRARDFRLEEDDLLR
VFDGSSNKARLLGVFTGSELLDTTLNSTSNSMWLEFISNADNTSKGFELHFISFELVKCE
DPGVPQFGYKREDRGHFAGSTVSFSCDPGYMLKGPEVLTCLRGERRSWDSPLPLCVAECG
GTIKNEPSGRILSPGYPAPYEHNLHCIWTIEAPPGSTISLHFLVFHTEEVHDVLRIWDGP
NDGGVLLRELSGSALPQDAHSTFNTITLQFTTDFFTSKQGFALQFSVSTATSCNDPGMPT
NGTRSGDSREPGDHVVFQCDPGYILQGAKRIVCTEISGRYFWQPDPPTCTAPCGGNLTGP
SGMILSPDYPEPYPHGRECDWTVTVTPDYVIALSFNQFSLEPSYDFLHIYDGPDSLSPLL
GSFYGTDVPDRIESSSNTLFLAFRSDASLSSNGFVLQYTENPRESCFEPGGIRNGTRVGV
ELKLGSTITYRCDSGYTLEGDPTLTCIMGGDGKPSWNKAKPICIAPCGGQYTGLEGVVLS
PGYPGNYSRAQTCLYSVVVPKDYVVFSQFAFFHTALNDIVEVYDGATQHSRVLSSLSGAH
TDAAGESLPLATSNQILIRFTSKSQSSSRGFHLAYQEAVPQTSATQCSSVPEPRNGRRMG
NNFAVGAVIRFECSPGYILEGSSAIECLTVPNALAQWNSSIPSCIGQKSGFNTCRERSIF
GPWDAPDPLPAPLIGLYPIYTHQRSLSKIQVISFVTEQNWDSLEVFDGGDNTDTMLGSFS
GTTVPALLNSTSNQLYLHFFSDISVSAAGFRLEYKTVSLTSCPEPVVPMNGIKVGERLQM
NNVVSFLCEPGYTLQGMSHITCMPGTVRRWNYPPPLCIAQCGGIREEMEGMILSPGFPGN
YPSNSDCTWRIYLPVGYVFRGCHIQFLNFSTEANHDFLEIRNGPLDTSTMIGRFSGQDVP
SSLLTTSHETTIYFHSDHSQNKPGFRFEYQAYELQECPDPEPFRYGAVVGAGFNVGQSIS
FECLPGYQLSGHSILTCEHGTTRNWDHPFPHCEAPCGGNITLDNGTIFSPRYPEEYPNSA
DCSWLITVAPGFGVKVNFTLLQVHGPHDFITVWDGPQETARKLGIFTDGEPNEPPSSTSN
QVLIRFRSNTEKGGLFRIDYQAYRLQFCQPPPIIPNAEILMASKEFKIGDIVRYRCLPGY
HLSGNSILTCRLGTHLEFEGPPPSCDVTCPMNELLTASTGVIMSQSPGNGFPHFESCSWV
VKVEPGYNITFTIEHFQTSRQFDELEIFDGPSRQSPLLITLSGNYSSPLSITSSINKVYL
HWSFDHTTSHKGFRIRYSVAAYCSPPSFPINGSVHSLTGTKLGSTLRFSCDQGFRLIGQS
SATCTRTPQGIHQWNAPVPLCQVMSCGMPVPPVNGSIVGQDFSLGARSAYQCNPGFRLAG
PVTNSVICQESGRWSTTEALPRCIPVTCPDIGHSAVEHGRWRLIYGTQNQYDAIMMLVCD
PGYYYRGQRIIRCQVNGTWNYPDPRPVCDIISCRDLGTPPNGNKIGTLTVFGATAIFSCN
TGYTLVGSRVRECMSNGLWSGTQVQCLAGHCGTPEPIVNGQIIGENYNYRGSVVYQCNPG
FRLIGVSVRICEQDHHWSGLTPICVPITCGHPGNPIFGMTQGTQFNLNDNVRFVCNTGYV
LHGAVKSICQANGQWSNALPKCRIVNCTEPGHIENSIRQVLSSGPHRYSFQTAVSYRCNP
GYYLLGTSSISCQGDGTWDRSLPKCLLVLCDRPSVPPYAQISGDRRTVGSVIRYSCISQR
TIIGNTTRMCQLDGQWSGSPPHCSGDSAGLCGDPGVPVHGIRLGEEFSVGSIVYFSCEPG
YTLKGSPERSCLANETWLGTQPECHVISCGNPGTPRNAQILVHDGLTFSKSITYTCREGY
YSTGLLTRHCTVNGTWTGNVPECSVINCGDPGVPANGVRLGNDFTYNHTVTFQCSPGFTM
DADRASTLICTKDRTWNGTKPLCKAIVCGPPLSIPNGQVVGTEFTWGSSISYSCNQGYQL
SLPTVLTCQGSGNWSGEKPQCFPVFCGDPGVPAQGRREDRGFTYLSSVSFFCYAPYILVG
SARRYCQYDGIWSGTQPSCIDPTHTSCGDPGTPLFGNQNNTQGYQVGNTVFFSCRKGYLL
QGSISRTCMPNLTWSGFQPECIAHHCSQPELPAQSDVRAIELPSLGYTLIYTCQPGFYLA
GGSEHRTCRSDGSWTGKPPLCAADNRPSGKSPVGTVQEPPSKLPVPGGVFAKNSLWRGSY
EYLGKKQPAMLNITAFEPFSNRVNGTLIDHSGVELKLAGTYKREEAQLLLQVHQIRGPVE
IFVNKFKIDNWALDGHVSYISSSNSFVYQGFVRGKGFGQFGLQRLESLISFRDNQGYNFA
SNSSSVAAAILVPFIAMIIAGFALYLYKHRRRPKVPFNGYVGHENTNGRATFENPMYDRN
IQPTDIMAGENFYLFIHLVCLCF
Download sequence
Identical sequences H3CV01
ENSTNIP00000012085 99883.ENSTNIP00000012085 ENSTNIP00000012083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]