SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012114 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012114
Domain Number 1 Region: 412-677
Classification Level Classification E-value
Superfamily NHL repeat 1.31e-51
Family NHL repeat 0.0000623
Further Details:      
 
Domain Number 2 Region: 300-392
Classification Level Classification E-value
Superfamily E set domains 1.13e-23
Family Filamin repeat (rod domain) 0.0022
Further Details:      
 
Domain Number 3 Region: 91-140
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000443
Family B-box zinc-binding domain 0.0064
Further Details:      
 
Domain Number 4 Region: 2-48
Classification Level Classification E-value
Superfamily RING/U-box 0.0000016
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012114   Gene: ENSTNIG00000009249   Transcript: ENSTNIT00000012305
Sequence length 677
Comment pep:known_by_projection chromosome:TETRAODON8:21:4323351:4338124:-1 gene:ENSTNIG00000009249 transcript:ENSTNIT00000012305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLPCLHAFCRQCLEGQRSPGDPLKLRCPTCDQKVSISEAGVDSLPSSNFLFSNLLDVVAG
FVASEAEYRSIKIKIHAKQLSKPLGSDQIRGEVFLFFCESCSVPICRECSMGRHMGHTFV
YLQDAVQDCRAITIQLLAEAQQGRQAVQLSMEKVQAMAEQVEIKAKVVQTEVKALVLRHK
KALEERECELLWKVEKIRQVKAKSLYLQVEKLHQSLTKLDSTIAAVSQVLDEGRHLDLLL
ARERMLTQIHELKTLRGLLQPQEDDRFMFTPPDQALYIAIQSMGLISSGAFAPVTKAHGE
GLKGALRGKPASFTVTGYDHDGEPRLSGGDTVSAVIMSVPDGNLSSAEVTDHQNGSYTVS
YLPKCEGEHLVSVLVCNRHIQGSPFKVTVKSGRSYGSLGSQLSSFGCEGEGDGQLCRPWG
VCVDKEGYVVVADRSNNRIQIFKPCGAFHHKFGSLGSRPGQFDRPAGVACDSQRRIIVAD
KDNHRVQVFTFEGQFLLKFGEKGTKNGQFNYPWDVAVNSEGKILVSDTRNHRVQLFAPDG
SFLNKYGFEGALWKHFDSPRGVAFNHEDHLVVTDFNNHRLLVIRPDCQSARFLGSEGTGN
GQFLRPQGVAVDQENRIIVADSRNHRVQVFEPNGNFLCKFGAQGSGFGQMDRPSGVAVTP
DGIIVVVDFGNNRILKF
Download sequence
Identical sequences H3CV30
ENSTNIP00000012114 99883.ENSTNIP00000012114 ENSTNIP00000012114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]