SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Tetraodon nigroviridis 76_8 > ENSTNIP00000012176

Domain assignment for ENSTNIP00000012176 from Tetraodon nigroviridis 76_8

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSTNIP00000012176
Domain Number 1	Region: 10-166
Classification Level	Classification	E-value
Superfamily	TRADD, N-terminal domain	3.01e-60
Family	TRADD, N-terminal domain	0.00018
Further Details:

Domain Number 2	Region: 197-295
Classification Level	Classification	E-value
Superfamily	DEATH domain	2.39e-17
Family	DEATH domain, DD	0.0054
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSTNIP00000012176 Gene: ENSTNIG00000009310 Transcript: ENSTNIT00000012367
Sequence length	298
Comment	pep:known_by_projection chromosome:TETRAODON8:5:5257075:5259376:-1 gene:ENSTNIG00000009310 transcript:ENSTNIT00000012367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MADKTEDGGPWTGCAVLFLRSLSPNVNLLSLYKDHQEGKFTVFKVLKLTLIDSARGLRGY EILKVHDADPLLGVEVKFVDVAACQQFLSSYGSGALHQSLSQHACRLLALPQELRVETQL KASTHVLDLCLDDLQCCLKHIHLSQPERLCDEEIDHLEQMLQSQALRPAQQLSSTNQQVE SPVPNNCFRFQNRVFEDRILTAADVQSFSNGVGRQWKNVGRALGRSCRALKGPAIDNLAY EYEREGLYEQAYQLLNRFIQAEGRAAKLSRLVRALEDCKLTGLAENVLDIQPSDGLSS
Download sequence
Identical sequences	H3CV92 ENSTNIP00000012176 ENSTNIP00000012176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]