SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012216 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012216
Domain Number 1 Region: 23-143
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.49e-21
Family PLC-like (P variant) 0.07
Further Details:      
 
Domain Number 2 Region: 162-254
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.37e-21
Family Synaptotagmin-like (S variant) 0.0076
Further Details:      
 
Domain Number 3 Region: 305-507
Classification Level Classification E-value
Superfamily vWA-like 1.15e-19
Family Integrin A (or I) domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012216   Gene: ENSTNIG00000009348   Transcript: ENSTNIT00000012407
Sequence length 561
Comment pep:known_by_projection chromosome:TETRAODON8:5:6085919:6100558:-1 gene:ENSTNIG00000009348 transcript:ENSTNIT00000012407 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEIQEATSPATSLSGPAACVSKVELRVSCKALLDRDTLNKSDPCVILMVQTNGQWTELD
RTEVIKSNLHPVFAKVFSLDYYFEEVQKLRFEVYDIHGTHSIGTRDDDFLGGVECTLGQI
VAQKKMVKPLLLKYGKYAGKSTITVHAEEISGNNGYVELSFCAKKLDDKDLFSKSDPFLE
IYRINDDDTEQLVHRTEVIKNNLNPVWEPFKVSLISLCSCDDERKLKCLVWDYDSRGKHD
FIGEFYTTFREMQKISSGNKKVMWDCVNPKYKQKKRNYKNSGVVILSELKLHRVYSFLDY
IMGGCQIHFTVAIDFTASNGDPRNSCSLHYINPYQPNEYLKALIAVGEIQDYDSDKRFSA
LGFGARIPPNYEVSHDFAINFNPEDDECEEIQGVVEAYQNCLPKIQLYGPTNVSPIINRI
AKLAAGDGNIKDASRYHILLILTDGVVTDMADTREAIVRASYQPLSIIIVGVGNADFTDM
QILDGDDGVLRSPKGEPVLRDIVQFVPFRDFKTASPAALAKCVLAEVPKQVVEYYSHKAI
SPMCPLRDLRTPILSPVATTP
Download sequence
Identical sequences H3CVD2
ENSTNIP00000012216 ENSTNIP00000012216 99883.ENSTNIP00000012216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]