SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012239 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012239
Domain Number 1 Region: 752-828,867-954
Classification Level Classification E-value
Superfamily RUN domain-like 3.4e-35
Family RUN domain 0.0021
Further Details:      
 
Domain Number 2 Region: 961-1059
Classification Level Classification E-value
Superfamily Lipase/lipooxygenase domain (PLAT/LH2 domain) 1.27e-16
Family Lipoxigenase N-terminal domain 0.041
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012239
Domain Number - Region: 644-717
Classification Level Classification E-value
Superfamily SAICAR synthase-like 0.0785
Family Inositol polyphosphate kinase (IPK) 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012239   Gene: ENSTNIG00000009371   Transcript: ENSTNIT00000012430
Sequence length 1137
Comment pep:known_by_projection chromosome:TETRAODON8:5:6447317:6464278:1 gene:ENSTNIG00000009371 transcript:ENSTNIT00000012430 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TSLKMTTGFSSGSCRFADYFVICGLDTESGLEPDELSALCQYIEATKFRDGARASVLGEN
FEQSPLRRTFKSKVLAHFPDNVEWNPFDQDAVGMLCMPKGLAFRTQVDSREPQFHSFIIT
REDGSRTYGFALTFFEEVTSKQICSAMQTLYHMHNAEQYDILHTPILPPGSEEQRHQHAH
LRPVLHAAPAISRLQRFNSYDISRDTLYVSKCICLITPMAFPQACRKVLQQLHQAVSSPS
PPPLPLESYIYNILYEVPLPPSGRSLKFSGVYGPVVCQRPSTSELPLFEFPISEVFDLLG
VENVLQLFTCALLEMQILLYSQHYQKLMTVAESITALMFPFQWQHVYVPILPASLLHFLD
APVPYLMGLHSNGQDDRTNLELPQEANLCFVDIDNHSVELPEDLPQFPNKLEFIQEISEV
LMSFGVSPEGSVNSCESQPSYRGFRSVDMASDKRNGNLASPLNSYLLKENQTIARLQALV
KRTGVSLDKLEVREDASGSRDGRSQCDEQELKMHQVNIHVREVFANRFTQMFADYEVFVI
QPSHDKESWFTNRDQMQNFDKASFLSDQPEPYLPFLSRFLETQMFASFIDSKILCPDDEE
KDHTLRVFDSRVDKVRMLNVRTPTLRTSMYQKCTTIEEAEKAIEMRVSKIDHTALHPHLL
DMKIGQGRYEQGFFPRLQSDVLSTGPTSNKWAKRSAPAQWRRRDRQKQHTEHLYMDNDQR
EKYIQEARNLGTTIRQPKLSNLSPSVIAQTNWKFVEGLLKECRNKTKRMLVEKMGREAVE
LGHGEVSITGVEENTLIASLCDLLERIWSHGLQVKQGKSALWSHLLHFQENKEKNSTPGS
LGPPGLIHDTERRKSDGGLSAMAPLKVSLIQDMRCRHIQNMSEIKTDVGKARAWVRLSME
KKLLSRHLKQLLSDHELTRKLYKRYAFLRCDDEKEQFLYHLLSFNAVDYFCFTNVFTTIM
IPYHVVVVPSKKLGGSMFTANPWVCVSGELSETGVLQVPRNTLEITFECQNLGKLTTVQM
GHDNSGLYAKWLVECVVVRNEITGHTYKFPCGRWLGKGVDDGSLERILVGELMTPTTEND
ERMCRTPPQQSPGMMRRFVTISLKHQTNPELNTGQIQEGVGEAINGIVKHFHKPEKE
Download sequence
Identical sequences H3CVF5
ENSTNIP00000012239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]