SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012241 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012241
Domain Number 1 Region: 831-939
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.67e-25
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 2 Region: 309-429
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-18
Family Growth factor receptor domain 0.022
Further Details:      
 
Domain Number 3 Region: 34-154
Classification Level Classification E-value
Superfamily Growth factor receptor domain 6.91e-16
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 4 Region: 271-315
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000117
Family EGF-type module 0.018
Further Details:      
 
Domain Number 5 Region: 634-752
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000314
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 6 Region: 161-308
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000251
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 7 Region: 709-827
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000523
Family Growth factor receptor domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012241   Gene: ENSTNIG00000009373   Transcript: ENSTNIT00000012432
Sequence length 1015
Comment pep:known_by_projection chromosome:TETRAODON8:5:6471656:6484277:1 gene:ENSTNIG00000009373 transcript:ENSTNIT00000012432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARDLCLFLLLLNSHQSGALPEIRVRSGCVADPCAKGSDGCHIDAICQTTQGSYKCTCKA
GFKGDGHHCEDTDECDLEFNGGCVHQCNNIPGNYRCTCYDGFHLAHDGHNCLDVDECRFN
NGGCQHICVNTVGSYECRCKDGFFLSDNQHTCIHRSVEGLNCMNKEHSCAHICKETPKGG
VACECRPGFELARNQRDCILTCNHGNGGCQHTCEDTENGPICRCHPRYNLQPDRRSCKER
DEASSDASDHNSTSFTEVDKRVKRRLLMETCAVNNGGCDCTCKDTSTGVRCSCPVGFTLQ
PDGKTCKDIDECELHNGGCEHFCRNTIGSFECNCRKGFKLLTDERSCQDIDECFFERTCD
HTCVNSPGGFQCLCNKGYTLYGLAHCGDINECSVNNGGCEHGCENTVGGFECFCHPGYKL
HWNKKDCIEAQGLPLANPPSKATLNCSKQEGGDRCSLTCQSQVHISSGMEDSYTVTCGMP
LPCLADAQRNNSGLSCLGSEKATVPRIKTTATFKSGTSKCNLKRSQETLKQSLNSALPEN
VQFSYVRLRCTSSGQKPRSRHGRKASEEDGSSITAEFELDVNLEEVTAEGCDLSCVRRRS
EKRLRKTIRTLRKSINREQFHLHFAGSDYELGRSQSQPAELPGRCAMGQMPVGKKCVSCG
VGTHYDGDQGRCVLCPAGTYQDEEGQMFCEPCPGPEGREVSKVVGARNMSECGGQCSPGQ
YSRDGFVPCLLCPLGTYQSEVGRTTCFPCGGNLVTKRIGAVTFQECETKVQCSPGHYYNT
STHRCIRCPTGAYQGEFGQNYCVACPGNTTTDFDGSTNIMQCKNRQCGGQLGDFTGYIES
PNYPGNYPANVECTWTINPPPKRRILIVVPEIYLPIEDECGDYLVMRKSSLSNSVTTYET
CQTYERPIAFTSRSKRLWIQFRSNEGNSGKGFQVPYVTYDEDYQELIEDIVRDGRLYASE
NHQDILKDKKLMKALFDVLAHPQNFFNYTAQESREMFPKSFIRFLRSKVLRFLRP
Download sequence
Identical sequences H3CVF7
ENSTNIP00000012241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]