SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012283 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012283
Domain Number 1 Region: 121-256
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-23
Family Cadherin 0.0000851
Further Details:      
 
Domain Number 2 Region: 241-354
Classification Level Classification E-value
Superfamily Cadherin-like 7e-16
Family Cadherin 0.00011
Further Details:      
 
Domain Number 3 Region: 351-467
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000157
Family Cadherin 0.0018
Further Details:      
 
Domain Number 4 Region: 33-133
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000186
Family Cadherin 0.00061
Further Details:      
 
Domain Number 5 Region: 478-561
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000136
Family Cadherin 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012283   Gene: ENSTNIG00000009413   Transcript: ENSTNIT00000012474
Sequence length 777
Comment pep:known_by_projection chromosome:TETRAODON8:5:7687379:7692083:-1 gene:ENSTNIG00000009413 transcript:ENSTNIT00000012474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSAEEQPPRVLHPWRHRGRGLARVRRDWIIPQIRVLENSKQVPEALVQIKSDKIFTGEVI
YKLEGPGVDQEPKNLFEIDDKSGVIRSKQPLDREKHSSFTLKAFALSPSGERLENPTTIE
IVVLDQNDNRPVFTQSQFVGAVSEFSVPGTSVMSVSATDADDPTTENAILSYSIIGQESL
PPNAVTKVMFGINNETGTIYTRDVGLDREVVKSFRLRLQIADMSGQGLTSEGVAIIQVSD
INNHAPQFSPAAYSFKAVENRKSYEVGRVNVTDRDDPGTGNWEAKYSILNDQDGNFDIRT
DPVTNQGLLTVVKPLDFEARSEYSLKLRVENVNALSSKAQNPPVSTAAVRVTVVNQNEAP
HFSEDPVLIVVPESVPPGTLLKSNYVSDPDNSELRFEISRDPERWLDINRVTGDITAKRS
FNMRSPHVRNNVYRAVVKVTDAEGLSTSGGVSITLKETNDFPPQVVPGGGFVCKEATPEA
SGLVVTAVDQDFPPHAAPFRFEIPDDLPVNWTLSQLNTTHAVLHPLVQLEEGEYAVPLLV
SDSGRPALSSFTHVNVSVCLCDPSGDCKSAAGAVLGSSVGLSFIALIIVTASVALLLLLL
LLAAAVSACGRRHRLRKDTGLLVGESEDDVRDNVFNYDEQGGGEEDENAFNIDLLWNPHD
APPTPGSYYPTPGFPRGKQPLRRDAPHNLPSPVYPRRPPADPTDIEDYINDGLQAADGDP
NVPPYDTALIYDYEGEGSLAGSLSSIASGSSDGDQDYDYLNDWGPRFQKLAHMYDPR
Download sequence
Identical sequences H3CVJ9
ENSTNIP00000012283 ENSTNIP00000012283 99883.ENSTNIP00000012283

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]