SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012295 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012295
Domain Number 1 Region: 291-419
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-24
Family Cadherin 0.00044
Further Details:      
 
Domain Number 2 Region: 526-631
Classification Level Classification E-value
Superfamily Cadherin-like 1.23e-22
Family Cadherin 0.0043
Further Details:      
 
Domain Number 3 Region: 408-523
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-17
Family Cadherin 0.00051
Further Details:      
 
Domain Number 4 Region: 86-199
Classification Level Classification E-value
Superfamily Cadherin-like 6.57e-17
Family Cadherin 0.00041
Further Details:      
 
Domain Number 5 Region: 231-303
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000002
Family Cadherin 0.0035
Further Details:      
 
Domain Number 6 Region: 32-92
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000343
Family Cadherin 0.0067
Further Details:      
 
Domain Number 7 Region: 624-729
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000112
Family Cadherin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012295   Gene: ENSTNIG00000009425   Transcript: ENSTNIT00000012486
Sequence length 797
Comment pep:known_by_projection chromosome:TETRAODON8:5:7905297:7919164:-1 gene:ENSTNIG00000009425 transcript:ENSTNIT00000012486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKIGVPENYDGIFPWYLTKLLNLPPNHTDLVVTGDDEGIFGVDSQFLYALKPLDREKQPS
YSLQVSFRTPVSRQSFTVEVCVIDKNDNVPTFIRESMRGSVQLGLLKGIPFMQVEALDRD
ERSSVNAELRFSLLEQMPRIPSSQMFSIDSITGEVSLTEEGASTLDPEMCGRYKLSVMVK
DMAGKANAFFTTGIVIVEVTGNTWASPDPVRFQENFPGPYPIPISQVKWSGSQAEYNLEG
EFPEMLFTISREGVIYLNAPLDRETQDQFLISIVVERPDGRAIAKPVELRVMVGDANDNR
PTFPQAQYHTVVKELAARGTEILTVQAADNDDPKTDNVRIFYRLVGQIPESPRALFRVDR
DSGVISVQADSMEGTAPQYTLTITAEDAKGDFSLNSSCTVVVTVQDENNNPPVFSQHEYG
PFHIPENAPVGTTVTAVLAGDADVRGGDSWQVNYHLESGNEEEAFTLVTDKQTNEVALVL
SKVLDFERESEYILVLSAQNPVALVRGRYGPASTATVSIYVDDLNEGPILSQSHYEVTVR
EGEEPGRVIATIRGYDPDSHPIRYSLQGDTKKYFSIGKYSGELKTVQALDREENSTYTME
VIAVDGRNSSLSASTLVTVQILDVNDNSPVLVGDYSWKYLCTPRWEDQALVLASRDSDGP
QHGGRLNFSLRSDATVRHNWKLTPINDTHTNLSLNVPYLAPEVYTVPFTISDSSSPPRST
FINLPVTVCPCNVRGNCKMPVKQLQGMPTIQSAVGILLGTFTVIGTILVVVFVRLSYQNP
NESVKSNQETVPLKIAI
Download sequence
Identical sequences H3CVL1
ENSTNIP00000012295 99883.ENSTNIP00000012295 ENSTNIP00000012295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]