SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012325 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012325
Domain Number 1 Region: 4-46
Classification Level Classification E-value
Superfamily UBA-like 0.000000000442
Family TAP-C domain-like 0.021
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012325
Domain Number - Region: 51-176
Classification Level Classification E-value
Superfamily Tex N-terminal region-like 0.000667
Family Tex N-terminal region-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012325   Gene: ENSTNIG00000009453   Transcript: ENSTNIT00000012516
Sequence length 258
Comment pep:known_by_projection chromosome:TETRAODON8:5:8322308:8323516:1 gene:ENSTNIG00000009453 transcript:ENSTNIT00000012516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HKLKSSQKDKIRQFMSFTQAGERTAVFCLTQNDWKLEVATDNYFQNPDLYYKESMKSSVD
RKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLMLDPASVSILVVAWKFRAATQCVFSRKE
FLDGMAELGCDSTEKLKAVLPRLEQELKDSGKFKDFYQFTFNFAKNPGQKGLDLEMAVAY
WNLILTGRFKFLELWNRFLLEHHKRSIPKDTWNLLLDFGNMIADDMSNYDEEGAWPVLID
NFVEFARPIVAADKRSLT
Download sequence
Identical sequences H3CVP1
99883.ENSTNIP00000012325 ENSTNIP00000012325 ENSTNIP00000012325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]