SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012336 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012336
Domain Number 1 Region: 550-667
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-28
Family Cadherin 0.0029
Further Details:      
 
Domain Number 2 Region: 445-553
Classification Level Classification E-value
Superfamily Cadherin-like 5.71e-27
Family Cadherin 0.00089
Further Details:      
 
Domain Number 3 Region: 235-338
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-21
Family Cadherin 0.0026
Further Details:      
 
Domain Number 4 Region: 124-234
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-19
Family Cadherin 0.002
Further Details:      
 
Domain Number 5 Region: 657-763
Classification Level Classification E-value
Superfamily Cadherin-like 4.45e-17
Family Cadherin 0.0063
Further Details:      
 
Domain Number 6 Region: 380-457
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000286
Family Cadherin 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012336
Domain Number - Region: 21-89
Classification Level Classification E-value
Superfamily Cadherin-like 0.000432
Family Cadherin 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012336   Gene: ENSTNIG00000009464   Transcript: ENSTNIT00000012527
Sequence length 873
Comment pep:known_by_projection chromosome:TETRAODON8:5:8779621:8782239:-1 gene:ENSTNIG00000009464 transcript:ENSTNIT00000012527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YIVLLYSSPPFCLANFNQAKELIYKIKEGLPKGTYIGAIGLDLNLDFTVDPPFSFSFAQK
KVNEQYVFLNNTSGELYTTATEIDRETLCPDSHEQWGCILPLDVFVLPQQYFQLVKVKIL
IQDVNDNRPKFPVDQISITIPENALVNTRYAVEQSAMDPDLGVHGVQTYWLVNDFGVFTL
DVEENDGGELTPFVIVTEALDRETQAEYVTDIIAEDGGTPPLLGAATLIILITDVNDNCP
QFTESQINVTLHGNASKGTHLARLHAFDPDLGANAQISYAYSERMPRDTRSLFHLDKITG
VIKLAKKLDTGATTFYKLTVLANGPGCIPAVSTIHVNIIKIVTGPPAVITRYIAPEKDGV
VTLKESEPAFSPIAFFTVKNIGINQKVECYLEGSGPFRLTPYQLLRNEYLLETTENLDYE
KIRDYELVVVARKTQDLVIKTFLKVQVLDENDNAPVFEQSLVKILIDENNSPNTFLTQLQ
ATDQDSEERGEVVYLLGGDAPEIFVLDRVTGVLTVATSLDREEKETYRFIVRAVDKGTPK
RESIATVVLTVQDRNDNSPRFLNKDFTFFVPENFPGYGEIGVMSVTDADAGENGWVALSI
VNGSDTFMIDTGRGALRAKTSLDREQQGTYQLWIEAVDGGEPALSCVTMVTVLLLDVNDN
PPIVLFPQSNQSYMLVLPSTLPGTSITEVYAVDRDTGMNAVIAYSIIKRKGGDPGSFAID
PETGNITLKRELSNRGLHSLLVKVSDHGQPEPLYSTVMVNFFVNETVSNESYIQSLLTKE
ADIEVEERPWYISRMREGPERYESLNCQPVLIVLSVMCLGLFFLVIMLTSFLCLRRFKKH
RKKQSEAEIPLKMKNDLAQGVNRKIRQADLKHL
Download sequence
Identical sequences H3CVQ2
ENSTNIP00000012336 99883.ENSTNIP00000012336 ENSTNIP00000012336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]