SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012337 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012337
Domain Number 1 Region: 239-364
Classification Level Classification E-value
Superfamily Cadherin-like 7.2e-31
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 559-677
Classification Level Classification E-value
Superfamily Cadherin-like 5e-29
Family Cadherin 0.0019
Further Details:      
 
Domain Number 3 Region: 462-563
Classification Level Classification E-value
Superfamily Cadherin-like 6.81e-28
Family Cadherin 0.0016
Further Details:      
 
Domain Number 4 Region: 135-243
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-23
Family Cadherin 0.0036
Further Details:      
 
Domain Number 5 Region: 351-460
Classification Level Classification E-value
Superfamily Cadherin-like 3.53e-17
Family Cadherin 0.0065
Further Details:      
 
Domain Number 6 Region: 667-775
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-16
Family Cadherin 0.0051
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012337
Domain Number - Region: 33-121
Classification Level Classification E-value
Superfamily Cadherin-like 0.00557
Family Cadherin 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012337   Gene: ENSTNIG00000009465   Transcript: ENSTNIT00000012528
Sequence length 1202
Comment pep:known_by_projection chromosome:TETRAODON8:5:8995463:9116393:-1 gene:ENSTNIG00000009465 transcript:ENSTNIT00000012528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLKDYYLLGALLACLLIDPSIAQELIYPIREELQENVLIGNIPKDLNISHTNAATGASA
NLVYRLVSKAGDNPLVRVLSSTGEIFTTSNRIDREKLCPSPSFEDSECSFEIEVVILPND
YFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDTGPNSVHKYEL
INGQSAFGLDIVETSEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVT
VTDVNDNRPVFKEGQIEVHIPENSAIGTSVMQLQATDADIGANAEIHYVFGTQVSPSTKR
LFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVTINVTDVNDNPPNIDLR
YIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLL
ETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNAPIFTQPVIELEVMEN
NKRDRFLATISATDEDSGKNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFT
VTARDNGTPPLQTQATIIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDA
GENAAVSLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAVDSGRPPCSSAAKV
TINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDGDTGMNAELKYTIVSGN
NKGLFRIDPVTGNITLEEKPIVTDIGLHRLVVNISDLGYPKSLHTLVLVFLYVNDTVGNS
TLIYDLIRRTMETPIDRNIGESSETYQSGDYLTIMIAFVTGALVVIIVIFVTVLLRCRHA
SRFKAAQRKKQGTEWMSPNTENKQNKKKKRKKRKSPKSSLLNFVTIEGNKPNDPAHEPIN
GTISLPTELEEQGIGRFDWNATPTTTFKPNSPDLARHYKSASPQSAFHLKADTPVSVKKH
HVIQELPLDNTFVGGCDTLSKRSSTSSDHFSASECSSQGGFKTKGPMHTRQQSQRRVTFH
LPDGSQESCSDSGLGDHEPVGSGSLLTQPLPLVQAQDDFYEQASPDKRTEADGNSDPNSD
GPLGPRGLVEATEMCTQECLILGHSDNCWMPPTLGTYQQPKSPVSGFGPQREWVPKDKLI
NGHTLTRTWKNESSRTEHFSDRKQFGSGEGHFTSSSMADIPLVSLKSCQSASCPDSPKDQ
QL
Download sequence
Identical sequences H3CVQ3
ENSTNIP00000012337 ENSTNIP00000012337 99883.ENSTNIP00000012337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]