SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012342 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012342
Domain Number 1 Region: 887-1202
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.81e-65
Family Ankyrin repeat 0.0000496
Further Details:      
 
Domain Number 2 Region: 1246-1378
Classification Level Classification E-value
Superfamily TPR-like 4.27e-22
Family Tetratricopeptide repeat (TPR) 0.0016
Further Details:      
 
Domain Number 3 Region: 316-385
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000148
Family Extended AAA-ATPase domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012342   Gene: ENSTNIG00000009470   Transcript: ENSTNIT00000012533
Sequence length 1447
Comment pep:known_by_projection chromosome:TETRAODON8:5:9270452:9301412:1 gene:ENSTNIG00000009470 transcript:ENSTNIT00000012533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTKGVSISLPSSPLFPRQADIVPSQSCIRFTAVAKGRVRRLEYVDGSISPREAPAFASCC
GRTDCRGENFHVEPQLGSSLSTQELMTRLGFLLGDVTPGTASSPMEDRREKKCDPSALGG
SPSSTLTCSTASPCSESPFSTLNTSAGGRASRSSPGLPSQSPTSTLESKDSGIIATITSS
SENEERSASSEVLTKDEGLGGGVGVMGHAGEDCQPGRNRDGQNAQPDEALPRNDIMEPRT
PPAPKRPLPPTHIHSLSSLAMPRPNSVAATSSTQLEDLGFLNNQRVAGHRGSVRKHNTAG
RPSDDVKGRLMPFKQADVMLKPLLFEVPGITAETPFVGREWVFTRLEEVLRKTSSCEGRG
AVVVGNAGSGKTAIIWRLVTLSCHGMSTLQGGPSIPQSPSSSPKCGDRQGKAACKELANF
PANQSAAAGASDGAADRKEPVRSLAAKVVAYHFCQADNTYTCLVPEFVHSIAALLARAPQ
FTPYRELLVQEPHLQNTLSLRSCVQDPTAAFRGILEPIASLRKERKLPEEDYIILVDSLN
EAEFHKPDYGDTIATFITKIVSKFPPWLKMVVTVRTGLVEITTLLPFSGISLDILQDSSD
LGADLSDYIHHRVNSSTQVAANVTTPTGSAPDQLLLSKFSSHLSTRSHGSILYLQLTLDL
FHKGHLVLKGGNYLVVPVSLSEVYLLMCRVSFPDKEAFERILPVLNVALASLHPLTDEQM
FRALNAGSVKGELEWKDFQQRLESLAGFMVKRRDGTRMLCHPSFREWLVWRADGESSDFL
CEPRSGHALLAFMFSRQEGKLNRQQTMELGHHILKAHIFKGLSKKTGVSSSVLQAMWVNC
STDSLSAALASLRNLYTPNIKVSRLLMLGGASTSWCTEVIGHAPILAVHAHLGHVEMVGL
LLEMGAPVEGTTDSGMTPLCLAAAAGHADIVSLLCKKGAKVGHTDKNGQCALVHAALKGH
AEIISIFLGQDWGAEMTSDAQQQQPGDQNVTQKTQAVQQALTAAASLGHTQVVKNILELK
DEQLAVQMDAQDALWGETALSAASGRGRMEVCAFLLEHGPNLEIANRRGMVPLLSATKHG
HTQVAELLLKQGADINVSDKLGRTALMLAAAEGHHSTVELLLSKGPPLSSADQEGLTALT
WACLKGQKGIVQLLLEAGADLNQPDRQGRTPLDLAALNGDADTVHCLVEHGAVLERTDNG
GARDRTSGCQNPALVASLLKKASKTGHATWAMASSKPDILLILLQKLMEEGNILYKKGRM
KEAGQRYQYALRKLPREGQGDEPKGFKDLRVSLYLNLSRCRRKTNDFGIAEEFATKALEL
KPRSYEAYYARARAKRSSRQFAAALADLHEAARLAPSNREIRRLLVRVEEECKHYQRASS
TSRDPHAYHHHAPDEEMDIYSQGSLERQVPTDPADEDKEEESEDAEEQLLPTRASPGVPT
PFLQLLQ
Download sequence
Identical sequences H3CVQ8
ENSTNIP00000012342 99883.ENSTNIP00000012342 ENSTNIP00000012342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]