SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012346 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012346
Domain Number 1 Region: 136-279
Classification Level Classification E-value
Superfamily C-type lectin-like 4.39e-27
Family C-type lectin domain 0.00076
Further Details:      
 
Domain Number 2 Region: 3-117
Classification Level Classification E-value
Superfamily C-type lectin-like 2.97e-21
Family C-type lectin domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012346   Gene: ENSTNIG00000009474   Transcript: ENSTNIT00000012537
Sequence length 336
Comment pep:known_by_projection chromosome:TETRAODON8:5:9408865:9410355:-1 gene:ENSTNIG00000009474 transcript:ENSTNIT00000012537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTYEVLAWRLTWYQALKECGVRGGHLASVHDIQQNQRLSLIVKTDGFPLWIGLSNQDFSG
SAYEWSDGTKLDYNVALAGSRTDFISGKPGPNCVFIAPDGAWTRTSCNAAVDGAICYNTT
VTTAFQRARLQAPPEANGCPQGEGGSQWVQHQDQCYAFNMSFYNYSVHSMEKAEKICQAM
DAQLLTIKSTEENDFVSKYLYNDPFITRRTWLGMTLDSQGKPVSWKDGSALVYSNWKSEA
SLSDGRSKPPCPVMMWDEGKWNFVNCKTTYSRVVCKTEARSAGTSAALVFFILVLIAVLL
VAAYVIYKKKRGYFSSTIRYERTLDDMDTSSAVELS
Download sequence
Identical sequences H3CVR2
ENSTNIP00000012346 ENSTNIP00000012346 99883.ENSTNIP00000012346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]