SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012347 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012347
Domain Number 1 Region: 182-321
Classification Level Classification E-value
Superfamily C-type lectin-like 1.39e-29
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 2 Region: 1201-1339
Classification Level Classification E-value
Superfamily C-type lectin-like 5.07e-29
Family C-type lectin domain 0.00079
Further Details:      
 
Domain Number 3 Region: 333-466
Classification Level Classification E-value
Superfamily C-type lectin-like 8.76e-29
Family C-type lectin domain 0.00077
Further Details:      
 
Domain Number 4 Region: 1076-1196
Classification Level Classification E-value
Superfamily C-type lectin-like 2.27e-28
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 5 Region: 781-913
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-28
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 6 Region: 624-769
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-27
Family C-type lectin domain 0.00083
Further Details:      
 
Domain Number 7 Region: 922-1064
Classification Level Classification E-value
Superfamily C-type lectin-like 1.59e-24
Family C-type lectin domain 0.002
Further Details:      
 
Domain Number 8 Region: 476-612
Classification Level Classification E-value
Superfamily C-type lectin-like 8.57e-24
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 9 Region: 2-126
Classification Level Classification E-value
Superfamily Ricin B-like lectins 2e-21
Family Cysteine rich domain 0.02
Further Details:      
 
Domain Number 10 Region: 126-184
Classification Level Classification E-value
Superfamily Kringle-like 1.74e-20
Family Fibronectin type II module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012347   Gene: ENSTNIG00000009475   Transcript: ENSTNIT00000012538
Sequence length 1414
Comment pep:known_by_projection chromosome:TETRAODON8:5:9422255:9431066:-1 gene:ENSTNIG00000009475 transcript:ENSTNIT00000012538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EKGLFIMESEPLKRCITVDRSNLVLDDCERPTRSMLWKWVSQHRLFNLGTGTCLGLNLLN
KTQPLGTFACDTTLSVLWWRCNGKILQGASQWKAAVTGRLVVVKRNVHHLWKRYNTDKEG
PCSQPYEDIHTLLGNAHGMPCALPFKYNNKWYYECTDEGRDDRLLWCATSTHYDDTKKWG
FCPVQDNSCGQFWETNEKLRACYQFNLYTILTWSQAQSTCQAQGGNLLSITSLAEHSYIR
DRLASIGAMVWIGLNHLKDGWGWQWSDRAPLSLVNFTTALPASPLQDNRQCGVYNSAYEG
RWQSLSCESALPYICKKTPNDTRRAEPLERTGQYIHTECSSGWWPHNGFCYRVLSEAEGT
WEESSEACNAQGANLTSIRSLSEVEMLLDLLAGYSGDSTEVWIGLWKPGPSPAVEWSDGS
PVTLTLWHQYHPPPNQTDILCAKADRKEGNWLLVSCDERLPALCRRKSQIPINHSENVDT
GCPEGWKRHKHSCYAVTDREQINEDARMGYYCHGPLLTVEDRFEQAFVNSLLSARGANSS
RYYWIGLMSADDDGAYLWDHSTDPLKPLTYTNWNKHQPVSGSGCVVMSGGPALGRWEVKN
CRTFKALSLCKQSVYNDNDFQLPKRFSDPSAPCPPGWESHSELLLCFKVFHDEKVLMKRS
WVEADFFCQALGAQLASFSHLKEQIFVKQLLSTMFDGTEGRSFWVGLNKRDPEHPGGWEW
SDGTPVLTTFIEDSAEDDDRRHCAVYSYLSNAFVPQLCDAQHEWICKISKGDKLKKPYWY
TEHDEPWVFYRGAEYLLVQRPFDWDSVSLGCQMVGASLLSIHSREELHFVKEHMRRLSLG
PTDWWIGLSIGQPGEEVRWSDRTEVEFQNWAEASALGPRRDRMCVAMSSSSGKWSRSKCN
NLRGYVCKRKIVSVLETPREPHYVGRCPEKWLYFGHKCLLLHLPSSPKEGKTWKDAQSIC
SSFQSSLVTIDSEIEQAFITMLLQGSAVGVWISLKWTGYRNWSPVERDLTVSASSLKRCH
EEPSCTVLSNNHNFHMTGKWYDEKCSESGYGFVCQKPQDTSKSPTHSYHHPLPAKIEYRG
HNYRVLSGNLSWYDAMVTCRENHSDLVSIMDAYHQAFLTVLVNRLGAPHWIGLHTFQSGI
SYKWSDGSETVYTHWDAEDDDEDSLTEDCVYVDVNGRWRRADCETPLPGALCQEPHPSSK
PFISSEVVCPSAWVKFEQSCYTFEPVVYQLTFEKSREHCRLMANHSDVLTVASDKENRFV
LEQLWTLGLLHQTVWLGMYFNQDNNSMLWVDGSPVHYNNWPNKSPEPGLLSADVCVTTRG
ADGVWRLLQCTEQLGFICKTTKGLHHSAIPAAVLGAVLIFALLAGATWFAHKKNTLCFRG
LPPLIGSIYYRQSEAHTDSDGNVLITDLSTYSGQ
Download sequence
Identical sequences H3CVR3
ENSTNIP00000012347 ENSTNIP00000012347 99883.ENSTNIP00000012347

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]