SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012348 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012348
Domain Number 1 Region: 127-373
Classification Level Classification E-value
Superfamily vWA-like 1.5e-79
Family Integrin A (or I) domain 0.000000104
Further Details:      
 
Domain Number 2 Region: 372-457
Classification Level Classification E-value
Superfamily Integrin domains 1.46e-22
Family Integrin domains 0.00034
Further Details:      
 
Domain Number 3 Region: 22-78
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000785
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 4 Region: 614-694
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000824
Family Integrin beta tail domain 0.0024
Further Details:      
 
Domain Number 5 Region: 573-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000642
Family Integrin beta EGF-like domains 0.0018
Further Details:      
 
Domain Number 6 Region: 530-568
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family Integrin beta EGF-like domains 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012348
Domain Number - Region: 79-151
Classification Level Classification E-value
Superfamily Integrin domains 0.000204
Family Integrin domains 0.0013
Further Details:      
 
Domain Number - Region: 497-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family Integrin beta EGF-like domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012348   Gene: ENSTNIG00000009476   Transcript: ENSTNIT00000012539
Sequence length 768
Comment pep:known_by_projection chromosome:TETRAODON8:5:9432866:9440010:-1 gene:ENSTNIG00000009476 transcript:ENSTNIT00000012539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGVKWVFLVFFFLSSPCGAAGSCSVGSAATCDECLQLSSHCAWCTQENFTDWFSVGQRCD
TLEVLLEKGCARSYLEFPVSEARVLENSPLGKRTESDNSTQISPQKIALKLRPGSQVTFQ
VKVQHTEHYPVDLYYLMDLSASMVDDLQRIKDLGSTLSKEMANLTNKFRMGFGSFVEKPT
LPFIKITEEELANPCSSVSPHITCLPAFGYKHVLSLTSDANQFNQIIAKQRVSANIDLPE
CGFDAIMQAAVCGDKIGWRNDSMRLLVFVSDADSHFGMDSKMAGIVVPNDGRCHLDANNE
YSMSTMLEYPTLGQLIDKVVENNILLIFAVTEQQIHNYKNYANFIPGATVGVLANDSINI
LELIVTAYKELRSEIELEVLGDTEELQMSFTATCPNGIVLPDLKRCSNVKPGEMVVFNVS
VALPGCLSGLRHFSLKPVGLQDTLEVELESLCSCDCPSPPEANSSQCVEGKGAFHCGVCV
CQPGFEDSAFSTDCLASNESEVCSGQGRCFCGQCVCHASNFGHIYGRHCECDDYSCGRFR
GELCGGHGVCDCGECRCEDGWDGSYCNCSTGTEACTAEDGALCSGRGRCECGRCVCSVPG
ASGDRCEKCPTCGDACTSARICVECHLEEEDAELCQEKCSIPKISINTTADYDKSTSLQC
TVMTENECQISFNVVASETQTTAYNLRIYGCPKPPKIFMIVLGLSLSVVCIGLVLLVVWK
VLVSFHDRKEVARFEAERSKAKWQTGTNPLFRSSTSTFKNVTYKETHK
Download sequence
Identical sequences H3CVR4
99883.ENSTNIP00000012348 ENSTNIP00000012348 ENSTNIP00000012348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]