SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012362 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012362
Domain Number 1 Region: 149-322
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.94e-40
Family SPRY domain 0.00069
Further Details:      
 
Domain Number 2 Region: 9-144
Classification Level Classification E-value
Superfamily Fibronectin type III 1.71e-17
Family Fibronectin type III 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012362   Gene: ENSTNIG00000009489   Transcript: ENSTNIT00000012553
Sequence length 329
Comment pep:known_by_projection chromosome:TETRAODON8:5:9599720:9603480:-1 gene:ENSTNIG00000009489 transcript:ENSTNIT00000012553 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQVSKVKVKETHCSVTDLLPNAQYELWVTATNTTGISPASEKALYMTVPSPPVIKGREC
TSCPEAAFISWDSGNTNPVDSYTVELSEMSAASTHSDVTESIVGVPTCQCVVQLQHGRRY
LISVRAVNVGGSSNRSEILTVSTTGTFFHLLEDTAHPCLSISEDGFTIFYEDEELPISAM
ASDDNTFTRCVAILGDLIPVRGRHYWEVEVDDDTEFRIGVAYMDTERNSYLGANSTSWCM
RHIVTPSRHKYEFLHNGWSPDLRITVNPVQIGVALDYQEGTVSFNVDLKQHLHTFRCHFQ
NYVHPCFGLDSPGALTVHNAIEAPDYAFV
Download sequence
Identical sequences H3CVS8
ENSTNIP00000012362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]