SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012414 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012414
Domain Number 1 Region: 287-446
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.13e-56
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000284
Further Details:      
 
Domain Number 2 Region: 125-286
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.06e-48
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000561
Further Details:      
 
Domain Number 3 Region: 89-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000768
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 43-93
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000244
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 5 Region: 3-41
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000104
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012414   Gene: ENSTNIG00000009541   Transcript: ENSTNIT00000012605
Sequence length 447
Comment pep:known_by_projection chromosome:TETRAODON8:5:10234390:10238399:-1 gene:ENSTNIG00000009541 transcript:ENSTNIT00000012605 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGDYCHEEHCHNGGTCVTGVGDDPFICICADGFGGDTCNLTQTGPCVSNPCKNDGLCEVT
SPTRRGDVFNEYTCKCQTGFEGVHCQINVNECAAQPCNNGGTCRDLDGDYTCQCPSPYVG
KQCQLRCTSLLGMEGGAIAESQISASSTHYGILGLQRWGPDLARLNNQGIVNAWTSASHD
KNPWIEINLQKKMRLTGIITQGASRLGTAEYIKAFKVASSLDGTTYATHKVQGQRKDKVF
VGNTDNDSTKTNLFEPSIVAQYVRIIPVVCRRACTLRMELVGCELNGCSEPLGMKSRLIS
DRHLSASSSFRTWGIDSFTWHPHFARLDKHGKTNAWSPAHNNRSEWIQVDLEKTKRISGI
VTQGAKDFGVVQFVSLFKVAYSNDGESWNTVKEENDGSDKLFQGNMDNNSHKKNLFEPPF
YARYVRVVPWEWHERITLRMELLGCDD
Download sequence
Identical sequences H3CVY0
99883.ENSTNIP00000012414 ENSTNIP00000012414 ENSTNIP00000012414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]