SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012425 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012425
Domain Number 1 Region: 37-254
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.26e-55
Family Ankyrin repeat 0.00035
Further Details:      
 
Domain Number 2 Region: 721-827
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000154
Family Myosin rod fragments 0.0031
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000012425
Domain Number - Region: 1196-1355
Classification Level Classification E-value
Superfamily Tropomyosin 0.000981
Family Tropomyosin 0.0077
Further Details:      
 
Domain Number - Region: 420-513
Classification Level Classification E-value
Superfamily Tropomyosin 0.00589
Family Tropomyosin 0.0095
Further Details:      
 
Domain Number - Region: 617-713
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0732
Family Myosin rod fragments 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012425   Gene: ENSTNIG00000009552   Transcript: ENSTNIT00000012616
Sequence length 1395
Comment pep:known_by_projection chromosome:TETRAODON8:5:10400293:10411897:1 gene:ENSTNIG00000009552 transcript:ENSTNIT00000012616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RESCMCCQEEEDMLSMCVCNSCCCSYPCQNTDWNKYDDRLMKAVERGEVDKVAAVLSKKG
VVPTKLDVEGRSAFHLAATRGHLDCLNLILAHNVDVTATDASGKNALHLSSRNGHSQCVQ
KLLQHNCPVGNVDLQGRIALHDAVMAGCSSSVKLLCDSGAAVNATDFDGRTPLVLATQMC
HPRICQLLLERGADITIRDKQNKTALILGCEYGCKDAVEVLLKSGADVKAVDSLGHDAFH
YARLSKNTELVALVKTHLDKITRDKETAKMEQWKHQQSVERFESLESNRRDQIIHDLERQ
NETLQESLKKYHQEQRALIDKVNLLQQQLTQEKLTVEGAQKEKEQLKGLLVAKDGEEGAR
GSETVKVQLRSTLGDYSGQSVIKGKENVLVKQAHSLDSDHIVQKLSVSRPGDKSQPTVGW
DVSGELNTLRQEHEAVKRKQHAAEEEVARLQSALNRKNRECQELVQSRDAIQKQADQQIH
ELEEALGDVQKRMLDSECKVKQLQAHVVAVKEHLGGQGVEDLRLQLQDVKAKYEGASAEV
GRVRNRLKQSEKALEEYKSSESQLAAEAERLGQDLDVVVAERDELAEVLVVMEAKLKEAD
TKHGSMVPAEKFDNMKNLLTNAVDEKERQLAELREDYDRVLEEVADLNRKMDGPPSQTSA
EEQQRLRASLEGQNDSLKQKLLELTAKSQDLICEVKEGKEERSILLEQLNEFRTRIEMDF
IPIRDYEEARKSMVMALEELEDKLVEASERYGKAEAQVQQLQAERTQLQENISSIQSSSK
THQSQLDELSSHNCDLLKKIELMQRQSEDGKKERVQLNARIQTLEKSLAAEYVPRQQHEN
VKAELGSALESARAETLQTQKEKKASEEELTKVKDGNDRLKEELEKLSQEMKDDRIHVKE
HKDATEKLKATVAEAETKVKEVTALYLSAQEETVKLTQELEAQKKELDTIQQAIQSKFIS
VAAAEEKQKAHLVQVADLQNKLAEMEAEYTKEKCAGQSNKQEQEKLKVEMESVQQRLDSA
LVTSERHRDVEEEFKSRCDQLTHKLSSLEQQHQELLLQKADLHEQNALCRTQNQNLQDRL
KAELTRIATYDSELKALHDAMQQAQTDCKKAREARQEEAQKVGALQKELQEQRRDQASLL
QQQAQSEERLEAEMAEISRLRLALREEEENSAQRAEDVSALQSELLQATQALEKVRYKEE
QMNQMKKEKQELEKEVTDLSSKLLGVADQCKEAQQEAARAREKESKVRAEMESIQEKGNT
IEGEIGELKKRYDESLSTIGDLQRRIQTSAQQTEAKDKKITELLTDVERLKQALSGLSQL
AYTSNTPSKRQAQHTDAMQAQIRSLQQQLADAERQHREVVSIYRTHLLSAAQGHMDEDVQ
AALLQIIRMRQELVC
Download sequence
Identical sequences H3CVZ1
ENSTNIP00000012425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]