SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012433 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012433
Domain Number 1 Region: 6-132,323-635
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 4.05e-54
Family Integrin alpha N-terminal domain 0.0006
Further Details:      
 
Domain Number 2 Region: 152-346
Classification Level Classification E-value
Superfamily vWA-like 1.63e-48
Family Integrin A (or I) domain 0.00000126
Further Details:      
 
Domain Number 3 Region: 769-902
Classification Level Classification E-value
Superfamily Integrin domains 8.89e-24
Family Integrin domains 0.0015
Further Details:      
 
Domain Number 4 Region: 637-767
Classification Level Classification E-value
Superfamily Integrin domains 3.66e-16
Family Integrin domains 0.023
Further Details:      
 
Domain Number 5 Region: 930-1112
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000115
Family Integrin domains 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012433   Gene: ENSTNIG00000009560   Transcript: ENSTNIT00000012624
Sequence length 1161
Comment pep:known_by_projection chromosome:TETRAODON8:5:10605251:10626272:1 gene:ENSTNIG00000009560 transcript:ENSTNIT00000012624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFNNCFNIDTKTHKIIKGPKQAQFGYTVQQHVAAGGEKWLLVGAPYEMNGPYQTGDVYKC
SLNRRNNGCSKLNLGTVSQNTRKISLTNVSERKDKMRLGMTLTSNPVDNSFVACGPLWSY
ECGSSYYRTGICSRVNASFKFSRTIAPAFQRCETYMDIVIVLDGSNSIYPWYEVQAFLIN
ILQKFYIGPEFTGQVGVLQYGEKVVHEFKLSDYKSVEEVVKRARSINQRGGEETNTALGI
NVACSQAFKHGGRRGAKKVMIVITDGESHDSADLQQVIKDCEKDGITRYAIAVLGYYNRR
GINPEAFLNEIKYIASDPDDKHFFNVTDEAALKDIVDALGERIFSLEGTSKNGTAFGLQM
SQAGFSAHNVENQDGILVGAVGAYDWNGGILKETRQGKVVPPKSSYTQEFPEELKNHGAY
LGYTVTSVVSARSGRLIVAGAPRFNHTGKVIIFTLKNSGDLTILLSLKGQQINYLFGLCS
VFFIQSHTLSHVHTLGSREKTAFLNSLPGSLFNHKLLYRILSLRKYLCALEIHNGGQNAR
FGSALAPVPDLNGDGFNDLVVGAPLEDDHKGAIYVFFSQQSRILRKYKQRIAAVDLAPGL
QYFGCSVHGTMDMNNDGSVDLAVGSLGAVVLLWSRSVIRIYTTVRFEPSKINIFVKDCQK
FTLKLTFQFISYRPPGINYNVSIAERRFSPRAVLDNPIKLQPQNLTLLPGEETCQHIYFH
VMETTDYARPIVFVVQVGLQDPEHGPVLDDSWPTVTRTELPFWNGCDEDERCMPDLALQS
TTDLMTRKRVIEGDRRRMVVDARLENKGENAYSARLNVTYTPNLRFSSLIVKDTSDIKID
CYTENKLRNEKICNVSAPFMRAKSQVLFRLELEFSRARVLDHVRVHLEVNSDGEETNTAD
NSEEIFYSLNYEADLLFTSQRESHPSRYDIKSELALEEPGVIGPPFNLTFQIQNLGYFPV
SDLQLNLEIPEMSKNGNRLLQISDVYIDKVESLNFVSKCNCLSHPLTQNQVDTLNLPFQC
RVNVASHREVAVRISGVMRVENLHADFRVALVKPLWGFLSLQLQFRIFQLVASASVELPS
SSPMFLPEERPVRHIILEIRKEGDQRVPTWIIIGSTLGGLLLLALLSLALWKLGFFQRTK
RRDENEPAANGFITYKSELNS
Download sequence
Identical sequences H3CVZ9
99883.ENSTNIP00000012433 ENSTNIP00000012433 ENSTNIP00000012433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]