SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012478 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012478
Domain Number 1 Region: 120-237
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.2e-31
Family Spermadhesin, CUB domain 0.00096
Further Details:      
 
Domain Number 2 Region: 402-453,480-573
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.89e-21
Family Eukaryotic proteases 0.0053
Further Details:      
 
Domain Number 3 Region: 272-335
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000486
Family Complement control module/SCR domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012478   Gene: ENSTNIG00000009603   Transcript: ENSTNIT00000012669
Sequence length 573
Comment pep:known_by_projection chromosome:TETRAODON8:5:11587924:11594891:-1 gene:ENSTNIG00000009603 transcript:ENSTNIT00000012669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFRIRSSHCGLVSLQKAEVHGLPRLTEDRCPSSRWNAMCRPCCEYQLIQCRCPSKGLKVG
YTVPCCRNALNQCDPCLIPPGCSLFENCKTCHNGTWRANDDFFINGKYCTDCRQGWSGGD
CKTCGGVLQRAQGHIALDSYPTNARCEWTVHVERGRVIELRFLLLSLESDHSCGYDYVEV
RDGDGLNSPVIGRFCGDQLPPPIKSSGSALRILFSSDGYNNFNGFVLIFQQITHLTCIPV
FCLLDINSRLLPACVSDATGQACSCQTSRSRCAPPPKLHNGYHKPAPATAGGAETIEFFC
NKPYILSGSQRIRCSSHGSWSNRQPKCVRACRQPRVSELVKQKVVKPQLTSRDTPKKKPS
SRLSKKLKQEDASIVELPGDFLPVNTVIEYKCASPLYEHAGSSRRTCLKSGKWSGRHVSC
TPVCGKFTNFSPHNLNKTQWPWHVAVYIRSPPDSPSTARPPGVDMFVQQGDSEESTFWVL
ACSGALLSQRSILVAAQCVVDGDKQQTLQPAQVRVVMGVHDQTSSDQRQIIRNLQVTDIL
VHPDFHFGAESNVAVLKLRDKAKISERVLPVCL
Download sequence
Identical sequences H3CW44
ENSTNIP00000012478 99883.ENSTNIP00000012478 ENSTNIP00000012478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]