SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012512 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012512
Domain Number 1 Region: 459-747
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-79
Family Protein kinases, catalytic subunit 0.000000000306
Further Details:      
 
Domain Number 2 Region: 951-1089
Classification Level Classification E-value
Superfamily FAT domain of focal adhesion kinase 5.23e-55
Family FAT domain of focal adhesion kinase 0.00000028
Further Details:      
 
Domain Number 3 Region: 177-297
Classification Level Classification E-value
Superfamily Second domain of FERM 1.94e-39
Family Second domain of FERM 0.00000223
Further Details:      
 
Domain Number 4 Region: 75-174
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.89e-39
Family First domain of FERM 0.000015
Further Details:      
 
Domain Number 5 Region: 298-406
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-35
Family Third domain of FERM 0.00000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012512   Gene: ENSTNIG00000009636   Transcript: ENSTNIT00000012703
Sequence length 1094
Comment pep:known_by_projection chromosome:TETRAODON8:8:5426204:5448318:1 gene:ENSTNIG00000009636 transcript:ENSTNIT00000012703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELSPLCILLYSLLEYDAQLAPGRSPESDMASSSYLEPNHNHSSAGGCGVKTRSGMSGSTG
VGTSGSAGGLERAPGSMDRVLKIFHYFETNSEPCNWASNIRHGEGTDVRGVIQKIAEIHK
LRCVSSLGLRLTHLHSDSLHWLHPDLGVSHIREKYEKQHPQDEWRYELRIRYLPKGYLSH
FSEDKPSLNYLYHQVKSDYMHHIADQVDQDVALKLGCLEIRRFFRDMPGNALDKKSNYEL
LEKDVGLRRFFPRSLLESLKAKTLRKQIQQTIKQFANLNDEQSIHKFFEIVSPIYRFDKE
CFKCALGSSWVISVELAIGPEEGISYLTDKGSMPTHLANFNQVQSIQYSPLEDKDRKGML
QLNVAGAPEPLTVTTASLTTAENMADLIDGYCRLVSSSPHSFIVRVHKDGDRALPSIPKV
SNHERRMEKRMDGVRSRAVCVSETDDYAEIIDEEDTYTMPSTRDYEIQRECIELGRCIGE
GQFGDVHQGLYISPENPALSVAVKTCKNSTSDSVREKFLQEALTMRQFDHPHIVKLMGVI
TENPVWIIMELCTLGELRSFLQVRKYSLDLATLILYSYQLSTALAYLESKRFVHRDIAAR
NVLVSTVDCVKLGDFGLSRYMEDSSYYKASKGKLPIKWMAPESINFRRFTTASDVWMFGV
CMWEILMFGIKPFQGVKNNDVIGRIENGERLAMPPQCPPTLYSLMTKCWSYDPSKRPRFT
ELKTQLSTILEEEKLQQKERNRMEMRRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFY
PSSQHPGHYQMAGYPGPHTLPSVPSALYPQQSAMVTPTMLTHTPPHGHEMALWGSGLEDR
AVDLQQCVGQQCLFMEEQLMMQQQQMEEDQRWLEQEERLLKPESRGSRGSLDREDGVLQP
PTGNQHIYQPVGKQEHAAPPKKPPRPGAQSNLACQTTGDGYNDGVKLQPQEISPPPTANL
DRSNDKVYENVTGLVKAVIEMSSRIQPAPPEEYVPMVKDVGLALRTLLATVDETLPQLPA
STHREIEMAQKLLNSDLALIGKMKLAQQYVMTSLQQDYKKQMLTAAHALAVDAKNLLDVI
DQSRLKMMAHSRPH
Download sequence
Identical sequences H3CW78
99883.ENSTNIP00000012512 ENSTNIP00000012512 ENSTNIP00000012512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]