SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012521 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012521
Domain Number 1 Region: 863-1073
Classification Level Classification E-value
Superfamily vWA-like 2.23e-59
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 5-191
Classification Level Classification E-value
Superfamily vWA-like 1.05e-57
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1092-1296
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.38e-32
Family Glycosyl hydrolases family 16 0.078
Further Details:      
 
Domain Number 4 Region: 392-552
Classification Level Classification E-value
Superfamily Fibronectin type III 2.3e-23
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 5 Region: 685-772
Classification Level Classification E-value
Superfamily Fibronectin type III 4.41e-20
Family Fibronectin type III 0.00071
Further Details:      
 
Domain Number 6 Region: 210-296
Classification Level Classification E-value
Superfamily Fibronectin type III 2.46e-17
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 300-388
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000238
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 8 Region: 591-671
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000979
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 9 Region: 804-871
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000334
Family Fibronectin type III 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012521   Gene: ENSTNIG00000009644   Transcript: ENSTNIT00000012712
Sequence length 1632
Comment pep:known_by_projection chromosome:TETRAODON8:8:5495841:5532385:-1 gene:ENSTNIG00000009644 transcript:ENSTNIT00000012712 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFVCRTEAIADIVILVDGSWSIGRLNFRLVRMFLENLVNAFDVGIDKTRIGLAQYSGDPR
IEWHLNAYSTKDAVIDAVRNLPYKGGNTLTGLALNFILENCFKPESGSREGLPKIGILIT
DGKSQDDVVPPAESLRNAGIELFAIGVKNADENELQSIASPPEDTHVYNVADFSVMNSIV
EALTRTVCEQVVQQDKEIKQISEHVPETVGAPHELVTSEVTARNFRVSWSPAPGNVEKYR
VVYYAARGEEPHEAVVDGSETSVVLDHLSSLTEYQLAVFAVYATEASEALRGSETTLALP
SVTGLQLLDVTHSTMKVTWDRVEGASGYLLLYGPLIEDGQLNEKELKLSNAVTELELQAL
NPHTEYTVTVYAMYGDETSDPMTTQETTLPLNPPSNLQFSDITHKSAHISWDSAFPAAKG
YRIVWVKTDGLVMEELIVGNVNSYDLSNLMSLTEYSVAVSAVYDEGQSEPLTDGFTTTPV
PGPLNLRSTNVSSDSFQVIWDHSANDIVLYRLSWAPFTGGDTKEVVLSGSNNRYVLTGLN
PSTEYEVLLTAVFRDESESDTISVIETTLAMTTTIATTTTGETCDVTVVRQAVRNLQLTD
ETTESLKASWEMNDPYVESYRISYFGNNHKEESVSIQFLVPGGQRRAVLPSLLSDTQYKV
TVTPVYVDGQDGISASAFSATLPLLSPGNLRVSEEWYTRFKVTWDPPQSPVLGYRIVYQP
VYVPEPLLETTVNEDVNSMVLLNLLPGTEYNVQLTASYPMGESEPLLKTAKTWKLGITQA
QGEYVKNSSSCSVLKVHRHCLVCLYVVLKDMQDGQKQEVTLGGGASRQCFYDLTPSSQYQ
ISVCTQMQETEGPSVSITDMTLPAPTQAPTEAPTTEPPPTIPPPKEVCKEAKADLVFLVD
GSWSIGDENFMKITRFLHSTVGSLDLIGTDGTQVAIAQFSDDARTEFQLSSHSNKEALLE
AIQKISYKGGNTKTGRAIKHVKESIFSLEAGARRGVPKVLVVLTDGRSQDDVNKVSKEMQ
MDGYIIFAIGFADADYGELVNIASKPSDRHVFFVDDLDAVKKIEEQLITFVCEAATATCP
SVLMSGNTIAGFRMMDKFGLVEKEYSTIPGVSLEPGSFNSFPSYRLHRDALVSQPTKYLH
PEPLPSDYTISIMLRLLPETPQEPFALWEILNKRNEPLVGLILDNSGKTLTFFNHDFKGE
FQTVTFEGNEIKKLFHGSFHKLHVTISKTSVKAVLDCSAVGEKSVYAAGNITTDGVEILG
RMVRSRGRRDSSAPFQLQMFDIICSTSWARRDKCCELPALRVEAQCPPLPHACTCSQDSK
GPPGPSGPPGGPGTRGARGDRGEPGLTGPQGPVGDRGSAGPPGPPGPQGPSGLSIQGPPG
IAGEKGERGANGPPGQMGLPGGPGTPGRDGPPGIRGLPGNIGPQGRQGPPGPLGAPGAPG
VPGPSGSAGSPGDQGIPGPAGAKGDKGERGDVQSQAAVRAIARQVCEQLIQSHLSRYNSI
LNQIPVQSSASVRTVPGPPGEPGRTGPPGPPGEQGPTGRPGFPGTNGQSGRPGERGLPGE
KGERGNPGVGSQGPRGPPGPPGPAGEGRAGSQGPPGRPGNSGTPGRPGNQCAPGQTGPPG
YCDQNSCLGYTV
Download sequence
Identical sequences H3CW87
ENSTNIP00000012521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]