SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012542 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012542
Domain Number 1 Region: 25-414
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 2.09e-105
Family Regulator of chromosome condensation RCC1 0.0000000000588
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012542   Gene: ENSTNIG00000009664   Transcript: ENSTNIT00000012733
Sequence length 417
Comment pep:known_by_projection chromosome:TETRAODON8:8:5743484:5745881:-1 gene:ENSTNIG00000009664 transcript:ENSTNIT00000012733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAKKTTKRRTEVVVDGDKHPKKVKVSHRSYGKEAGQVLVLGQGDVGQLGHGEDVLQRKK
PSLVSLPEKTVQVEAGGMHTVCLSESGHVYTFGCNDEGALGRETTEEGSEMVPGKVSLDE
KVVQVSAGDSHTAALTEDGRVFVWGAFRDNNGVIGLVEPLKTSKVPVELSMTEPVVKVAS
GNDHVVMVTLEGNLYTVGTGEQGQLGRVAEIFSNRGGRQGLDRFLIPQIVIIKGKVQFVD
AFCGSYVTFAVSKDGHVYGFGLSNYHQLGTKNTKTCFFPVKLTCFKNSTVSWVEFSGGQH
HTVCLDAEGKVYSLGRAEYGRLGLGQGTEEKSEPTLVTGIEAACSVTCGASVSYAVTKEG
AVYAWGMGTNLQLGTGEEEDEWSPVRMTGKQLENRAVLMASSGGQHTALLVKDEQES
Download sequence
Identical sequences H3CWA8
ENSTNIP00000012542 ENSTNIP00000012542 99883.ENSTNIP00000012542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]