SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012549 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012549
Domain Number 1 Region: 804-1113
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.36e-95
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000339
Further Details:      
 
Domain Number 2 Region: 1071-1372
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.99e-80
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000143
Further Details:      
 
Domain Number 3 Region: 1-118
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.23e-28
Family MAM domain 0.0000198
Further Details:      
 
Domain Number 4 Region: 323-528
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-23
Family Fibronectin type III 0.00076
Further Details:      
 
Domain Number 5 Region: 121-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000282
Family I set domains 0.0012
Further Details:      
 
Domain Number 6 Region: 217-355
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000902
Family Fibronectin type III 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012549   Gene: ENSTNIG00000009671   Transcript: ENSTNIT00000012740
Sequence length 1373
Comment pep:known_by_projection chromosome:TETRAODON8:8:5866620:5909278:-1 gene:ENSTNIG00000009671 transcript:ENSTNIT00000012740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSYMLVNSSQHAAGHRAQLLLQPMSENDTHCIQFSYFLYSRDGHSPGALRAYVRVNGGPL
GIPVWNASGSQAKQWHPVELAVSTFWPNEYQVLIEATISRERQGYIAVDDIMVLNYPCYK
APHFSRLGDEEVNAGQNASFQCVAAGRASEAERFLLERHNGETLTAASVKHLSHRRFVVS
FQLDNVQRADQDLYRCVTQSSRGSGVSNFAELIVKVPPSPIAPPQLLRAGSTYLIVQLNT
NSILGDGPIIRKEIEYRASQSPWSEVHAVNMVTYKLWHLDPDTEYHISVLLSRTKPEAGP
LPPSVPPILTHTASSKPMRALRGLVATDIQPRQLSLQWESLAFNLTRCHTYSVSLCYRYT
TAGGGGGHNTTVRECLAVEHNASRFTLRDLPPYHSVHVRLSLTNPEGKKEGREVTFQTDE
DIPGGIAPESLTFTPLDDMVFLKWEEPVEPNGLITQYEEQISYQSIESSDPGINVPGPRR
TVSKLKNETYHMFSNLHPGTTYLISVRARTAKGFGQTALTEITTNISAPTFDYGDMPSPL
SETDSTITVLLRPAQGRGAPVSTYQVVVEEEMVKKVKRELGLQECFPLPMSHGEAQARGT
PHYYTAELPPSSLPEASPFTVGDNHTYNGYWNSPLDPRKSYLVYFQAMSNFRGESRINCI
RIARKAACKDQRKALEVSQHSEEMGLILGVCAGGLVVLILLLGAVIIIIKKGKPVNMNKT
PITYRQEKSHLGSMERSFTDQSTLQEDERMALSFMDAHTCGTRGDARSLVNEASSLLGGS
PRHQCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYEFMERGRTYGWDCTK
KKDKTKGRHDTLLGYDRHRVKLHPLLGDPNSDYINANYIDGYHRSNHFIATQGPMEETLY
DFWRMVWQENCFSIVMITKLVEVGRVKCCKYWPDDSEMYGDIKITLLKTETLAEYTVRTF
ALERRGYSTKHEVRQFHFTSWPEHGVPYHATGLLAFIRRVKASTPPDAGPVVVHCSVGAG
RTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRINMIQTEEQYVFIHDAILEACLCGET
AIPMNEFAIAYKELLRVDSQSNSSPLREEFQTLNSVTPHLDVEECSIALLPRNREKNRSM
DVLPPDRALAFLVTTEGESNNYINAALADSFHRQAAFIVTPHPLPGTTADFWRLVFDYGC
TAVVMLNQLNQSNSAWPCVQYWPEPGLQQYGPMEVEFLSMSADEDVVTRLFRVKNVTRLQ
EGQLVVCQFQFLRWSAYRDVPDSKKAFLNLLAQVHKWQRECGEGRTVVHCLNGGGRSGSF
CACNILLEMIQYQNMVDIFYAVKTLRNCKPNMVESLDQYRFCYDLILEYLDCF
Download sequence
Identical sequences H3CWB5
ENSTNIP00000012549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]