SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012551 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012551
Domain Number 1 Region: 832-1135
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-95
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000000329
Further Details:      
 
Domain Number 2 Region: 1091-1395
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.48e-81
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000143
Further Details:      
 
Domain Number 3 Region: 3-123
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.47e-28
Family MAM domain 0.0000198
Further Details:      
 
Domain Number 4 Region: 328-533
Classification Level Classification E-value
Superfamily Fibronectin type III 2.01e-23
Family Fibronectin type III 0.00076
Further Details:      
 
Domain Number 5 Region: 126-229
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000281
Family I set domains 0.0012
Further Details:      
 
Domain Number 6 Region: 222-360
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000846
Family Fibronectin type III 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012551   Gene: ENSTNIG00000009671   Transcript: ENSTNIT00000012742
Sequence length 1396
Comment pep:known_by_projection chromosome:TETRAODON8:8:5866620:5909293:-1 gene:ENSTNIG00000009671 transcript:ENSTNIT00000012742 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSLSPGSYMLVNSSQHAAGHRAQLLLQPMSENDTHCIQFSYFLYSRDGHSPGALRAYVRV
NGGPLGIPVWNASGSQAKQWHPVELAVSTFWPNEYQVLIEATISRERQGYIAVDDIMVLN
YPCYKAPHFSRLGDEEVNAGQNASFQCVAAGRASEAERFLLERHNGETLTAASVKHLSHR
RFVVSFQLDNVQRADQDLYRCVTQSSRGSGVSNFAELIVKVPPSPIAPPQLLRAGSTYLI
VQLNTNSILGDGPIIRKEIEYRASQSPWSEVHAVNMVTYKLWHLDPDTEYHISVLLSRTK
PEAGPLPPSVPPILTHTASSKPMRALRGLVATDIQPRQLSLQWESLAFNLTRCHTYSVSL
CYRYTTAGGGGGHNTTVRECLAVEHNASRFTLRDLPPYHSVHVRLSLTNPEGKKEGREVT
FQTDEDIPGGIAPESLTFTPLDDMVFLKWEEPVEPNGLITQYEEQISYQSIESSDPGINV
PGPRRTVSKLKNETYHMFSNLHPGTTYLISVRARTAKGFGQTALTEITTNISAPTFDYGD
MPSPLSETDSTITVLLRPAQGRGAPVSTYQVVVEEEMVKKVKRELGLQECFPLPMSHGEA
QARGTPHYYTAELPPSSLPEASPFTVGDNHTYNGYWNSPLDPRKSYLVYFQAMSNFRGES
RINCIRIARKAACKDQRKALEVSQHSEEMGLILGVCAGGLVVLILLLGAVIIIIKKGKPV
NMNKTPITYRQEKSHLGSMERSFTDQSTLQEDERMALSFMDAHTCGTRGMSDAPRNSTMR
CLSLIRFFVTGDARSLVNEASSLLGGSPRHQCGRKGSPYHTGQLHPAVRVADLLQHINQM
KTAEGYGFKQEYESFFDGWDCTKKKDKTKGRHDTLLGYDRHRVKLHPLLGDPNSDYINAN
YIDGYHRSNHFIATQGPMEETLYDFWRMVWQENCFSIVMITKLVEVGRVKCCKYWPDDSE
MYGDIKITLLKTETLAEYTVRTFALERRGYSTKHEVRQFHFTSWPEHGVPYHATGLLAFI
RRVKASTPPDAGPVVVHCSVGAGRTGCYIVLDVMLDMAECEGVVDIYNCVKTLCSRRINM
IQTEEQYVFIHDAILEACLCGETAIPMNEFAIAYKELLRVDSQSNSSPLREEFQTLNSVT
PHLDVEECSIALLPRNREKNRSMDVLPPDRALAFLVTTEGESNNYINAALADSFHRQAAF
IVTPHPLPGTTADFWRLVFDYGCTAVVMLNQLNQSNSAWPCVQYWPEPGLQQYGPMEVEF
LSMSADEDVVTRLFRVKNVTRLQEGQLVVCQFQFLRWSAYRDVPDSKKAFLNLLAQVHKW
QRECGEGRTVVHCLNGGGRSGSFCACNILLEMIQYQNMVDIFYAVKTLRNCKPNMVESLD
QYRFCYDLILEYLDCF
Download sequence
Identical sequences H3CWB7
ENSTNIP00000012550 99883.ENSTNIP00000012551 ENSTNIP00000012551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]