SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012553 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012553
Domain Number 1 Region: 6-120
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-24
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 127-214
Classification Level Classification E-value
Superfamily LCCL domain 1.44e-23
Family LCCL domain 0.00097
Further Details:      
 
Domain Number 3 Region: 244-322
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000000161
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012553   Gene: ENSTNIG00000009673   Transcript: ENSTNIT00000012744
Sequence length 342
Comment pep:known_by_projection chromosome:TETRAODON8:6:2260694:2263827:1 gene:ENSTNIG00000009673 transcript:ENSTNIT00000012744 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSGNGCGHTVLGAESGTLASQNYPGTYPSNVWCRWKLRVSEGRTLRLLFGDFDVEDSPG
CATALMVVAAVPPSLTQQTRALCGTLDASQKNVTLKSNEVTISFRSGRHRSGRGFLLSYA
TDQYPGLISCLRRGSHFSSQHVSVYCPAGCRNVTEDVWGSWEQGYRDTSVLCKSAVHAGV
ISDGQGGHVAVTRGRSLTLYESAFANGILSKIGPLPVCKLFTSAHVASCVNTQGLHSEPI
LSSAPPTECNNILSDSGSNASSSSKNWGSGLDGQPRPGDEAAPSPWLELELRDRSTITGV
ITTGSAQFYIESYIVYFSKDRKKLEASQGRFEQGEEGVPGPH
Download sequence
Identical sequences H3CWB9
99883.ENSTNIP00000012553 ENSTNIP00000012553 ENSTNIP00000012553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]