SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012589 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012589
Domain Number 1 Region: 77-292
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.53e-71
Family Ankyrin repeat 0.000000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012589   Gene: ENSTNIG00000009708   Transcript: ENSTNIT00000012780
Sequence length 310
Comment pep:known_by_projection chromosome:TETRAODON8:14:8816527:8818201:1 gene:ENSTNIG00000009708 transcript:ENSTNIT00000012780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAHRVSTHHNQMDYNSLDSMEAKHGKMLPCQEDRFDSGLDSMKEEDLANHFEEMSVSEG
KDLPQEYEAWRAAVTDDGDTLLHLAIIHEATDHAHQMIRLSHHHPFLNVQNHQRQTALHL
AVITRQPQLVEKLLKAGADPRLVDNSGNTALHIACKRGSLASFGVITQNCRRHLTTILSS
TNYSGHNCLHLASINGYISLVESLVRLGADINAQEQCSGRTSLHLAVDLQNPPLVRCLLS
LGANVNCFNYGGFTPYHLTYGRQSEEIRCELYEKTAHELRELPDSESDESDMEEADTPED
ELYDDIKFWK
Download sequence
Identical sequences H3CWF5
ENSTNIP00000012589 ENSTNIP00000012589 99883.ENSTNIP00000012589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]