SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012604 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012604
Domain Number 1 Region: 58-399
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.13e-81
Family Protein kinases, catalytic subunit 0.00000206
Further Details:      
 
Domain Number 2 Region: 1030-1088
Classification Level Classification E-value
Superfamily Cysteine-rich domain 7.03e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.004
Further Details:      
 
Domain Number 3 Region: 1100-1224
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000532
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 
Domain Number 4 Region: 1256-1516
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.00000366
Family Tricorn protease domain 2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012604   Gene: ENSTNIG00000009723   Transcript: ENSTNIT00000012795
Sequence length 1727
Comment pep:known_by_projection chromosome:TETRAODON8:14:9108754:9142093:-1 gene:ENSTNIG00000009723 transcript:ENSTNIT00000012795 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGEVRLKKLEKLVLDGPAASNGQCLSVESLLDVLVCLYDECNNSPLRREKNILEFLDWA
KPFTSKVKQMRLHKEDFEILKVIGRGAFGEVAVVKVRNTDKVFAMKILNKWEMLKRAETA
CFREERDVLVNGDCQWITTLHYAFQDENNLYLVMDYYVGGDLLTLLSKFEDRLPEEMAKF
YLAEMVLAIDSVHQLHYVHRDIKPDNILLDVNGHIRLADFGSCLRLMEDGTVQSSVAVGT
PDYISPEILQAMEDGKGKYGPECDWWSLGVCMYEMLYGETPFYAESLVETYGKIMNHKER
FQFPQQVTDVSEEAKDLIRRLICSREHRLGQNGIEDFKHHPFFTGIDWENILTCEAPYIP
EVSSPTDTSNFDVDDDCLKNSETMPPPSHTAFSGLHLPFVGFTYTSKCTLSDQGCLRQLA
VDPGRAGKDQLDLDVQRGLEDSLATEAYERRIRRLEQEKLELTRKLQESTQTVQALQHQT
GEGPLSTNREVEIRSLKSEIDVLKKQIADSGQLEKQLEDVSLARRDLEDSSRHVKSLEKQ
MKSLTQERDELHKDVLEATEKLRSQSKELKEAHSQRKLAMQEFSELNERLTDLRSAKQRL
TRQLRDKEEEMESQTQRVEALRLEVRKAERAKKEMESQAEEQSAETLKERKMRERNEQYS
RQLEEELERLKAKQAGPSAAPSSVDQTQEVGRLRGDLEKKTLLYEEELARREAQHSTELK
ALRKDLRDAESQHLALQKEVLMLKDKLEKTRRESQSEREEFEADYKEKYERERSLLTEEN
KKLSSELEKLTGMFEKVSSSNRQLEDEMRELADKKESVAHWEAQITEIIQWVSDEKDARG
YLQALATKMTEELEGLRNTSLGARATDMPWKMRRFAKLDMSARLELQSALDAEIRAKQSI
QDELNKVKAGNIATECKLQDTESKNQELLAEIDRLKKEMEELRLRRGRAAELFFVQTNVF
VSLSLHSLVHQDSYSSSSSSLIEFWEDPLKRSPSVGPASKGRRLMDHPARPAQTPTLRSG
GYGSIGRSSPKSKAHQFVVKTFNTPTKCNRCTSLMVGLIRQGCTCEVCNFSCHVTCADKA
PAVCPVPPDQTKGPLGIDPQRGIGTVYEGHVRVPKPTGVKKGWQRAMAVVCDFKLFLYEL
GEGKATQPSVVVSQVIDMRDEEFSVSSVLDSDVIHASRKDIPCIFRVTASQLSPSSSHKP
SVLILADSDQERNKWVGLLNELHRILRKNKLKERFVYVPKEAYDSTLPLIKSTQSAAIID
HERVALGNEEGLFVVHVTKDEIIRVGDNKKVHHIDLMLQEQLLAVVSGRNRHVRLFLTQA
LDGRESESFKLAETKGCQSVASGQVRGGALTCLCVAMKRQIICYEVNKGKARHRRLRELQ
APASVQWMALLSERLYVGYQSGFTRYSVHGDAAPVSLLHPEDHTLAFIPQQSLDALCAVE
ISSKELLLCFSAIGVYVDSQGRRSRQQELMWPAVPNAGLSCCPGYNAPYLSVYSENAVDV
FDVNNMEWIQTIPLKKVRPLNVDGSLNLLGLETVRLVYFRNKMAEGDELVVPETSDNSRK
QMVRSLNNKRRFSFRVPEEERLQQRREMLRDPEMRNKLISNPTNFNHVAHMGPGDGIQIL
KDLPMVGEESQNQGQNQNPGPHPSSLPAPPPSSSSPWLAWPPASPSEKTPDLKRALRTLL
SKMKDSDSPRHSTASNSSTFSSPPSPASPHKTKSLSLESTDRMAWDT
Download sequence
Identical sequences H3CWH0
ENSTNIP00000012604

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]