SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012606 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012606
Domain Number 1 Region: 39-224
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.37e-22
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 254-403
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000586
Family Nucleotide and nucleoside kinases 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012606   Gene: ENSTNIG00000009725   Transcript: ENSTNIT00000012797
Sequence length 600
Comment pep:known_by_projection chromosome:TETRAODON8:14:9150591:9155269:-1 gene:ENSTNIG00000009725 transcript:ENSTNIT00000012797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKGVKRRREEHGRGYYEFIEENKYSWGSSFKSPVPPLEEEDEEIDDTKVCLDAYNCDLHF
KVSRDRYSASSLTMESFAYLWSGGKATYGVNKGKACFEMKITEKIPVKHISNKNTDIHDV
QVGWSLATGTLLLGEEEFSFAYSSKGKKTTKCVTEEFGETFEENDVVCCLIDCDGDEVVM
SYCKNGGEPATAFRISKDGLDGQALFPHIICHNCAVEFNFGQMETPYFPQPEGFTFLQQI
PVDDRVRGPRGPQTKADCEIIVMVGLPGSGKTTWVKNHVQEHPGKYYILSSDTIVDKMMI
NSLKRQSKDITKLTTISQRAPLFLGKFIEIAARKKRNYILDHTNVSAPGQKRKCLFAGFQ
RKAVVVCPSEEDYKQRVQQKVETDGKEVPEHAILKMKGFYALPEEGDSFGEVLYAELQKE
EASKLLEQYREESKTALPAEKKPNQGSTMPKRGGGQRGGGRGGKNQFGRGAGPGHRGGGR
GGFQNRGNYRGRANPGRGNFNRGHMPILGGSPRGGPMRGNMGPRGGHMNRGGPGHRGNMN
RGGNRGNFGNKNGNFNNRNSGNFGGNRNGMDKAQAFNQSWQQGQFWSQKPWNQQYQPGYY
Download sequence
Identical sequences H3CWH2
ENSTNIP00000012606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]