SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012669 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012669
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.18e-29
Family Ankyrin repeat 0.00086
Further Details:      
 
Domain Number 2 Region: 356-413
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000293
Family SAM (sterile alpha motif) domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012669   Gene: ENSTNIG00000009782   Transcript: ENSTNIT00000012861
Sequence length 429
Comment pep:known_by_projection chromosome:TETRAODON8:3:10867798:10871474:-1 gene:ENSTNIG00000009782 transcript:ENSTNIT00000012861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDRYHRAARDGRLDLLKEATRKELNAPDEDGMTATLWAAYQGNVEALRLIVSRGGNPDK
CDVWGNAPLHLAAANGHHGCLCFLVSVGANIWCQDNDYHTPLDMAATKGHMDCVRYLDNV
GAKQVELNAKLVRKLKEKAFCDAERRIEACMRIQEKHRKHMERRFRRETGKASACDATSF
SSYTSSSGSRRATLHATNKGKTKIQRKLEKKKQGDGTFKIYEDGNRGRRNVRDMFPRDNS
DAISRAISEPDLHGPDGDYSEISTDSGHDSLFNRPGLGAMVFRRNYMSGGMFELGGRGGE
VEGRSGDTVRLRSRLQPCSSLDEDSIGSARSLQERNVEEVPWEEVELGLDDDDEPETSPL
EVFLAALSMSELFFIFKREKIDLDALLLCSDQDLKSIHIPLGPRKKLLDACQKHLETIED
PECIEDTDL
Download sequence
Identical sequences H3CWN5
ENSTNIP00000012669 99883.ENSTNIP00000012669 ENSTNIP00000012669

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]