SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012680 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012680
Domain Number 1 Region: 3-247
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-85
Family IMD domain 0.00000000488
Further Details:      
 
Domain Number 2 Region: 375-436
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000117
Family SH3-domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012680   Gene: ENSTNIG00000009792   Transcript: ENSTNIT00000012872
Sequence length 520
Comment pep:known_by_projection chromosome:TETRAODON8:3:10951490:10978819:-1 gene:ENSTNIG00000009792 transcript:ENSTNIT00000012872 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FTMSRTDEVNRLTENVYKTIMEQFNPCLRNFVAMGKNYEKALANVTFAAKGYFDALVRMG
ELASESQGSKDLGDVLFQMAEVHRQIQVQLEEMLKSFHNELLAELEKKVELDARYLTAAL
KKYQVEHKNKGESLEKCQAELKKLRRKSQGSKNPSKYGEKEMQFVETISSKQTELDTFIA
EGYKTALSEERRRYCFLVDRQCAVAKNSSAYHGKGKDLLTQKIPVWQQACSDPNKLPERA
MLLAQQMGSAAIAGTSPLHTSKSNLVISDPIPGATPLPVPPELAVFMGRLMGPDGMSMVN
GTTGVHGEEYWTDGGTMSQTQGQAQAQPQKQVSDVYSNTLPVRRPAPAKSKNPVGETRTL
PRSSSMAAGLEKNGRSRVQAIFSHAAGDNGTLLSFSEGDVITLLVPEARDGWHYGENEKN
KMRGWFPFSYTRVLPESDSEKLKVNLHHGKSSSTGNLLENDGSLPTPDYGLTARLLAQSL
AQTRPRPYSMAGFGTQNAIEDYDGRFATSDSPEGKLISTV
Download sequence
Identical sequences H3CWP6
ENSTNIP00000012680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]