SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012721 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012721
Domain Number 1 Region: 42-179
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.77e-34
Family Galectin (animal S-lectin) 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012721   Gene: ENSTNIG00000009832   Transcript: ENSTNIT00000012913
Sequence length 180
Comment pep:known_by_projection chromosome:TETRAODON8:17:10081226:10083434:1 gene:ENSTNIG00000009832 transcript:ENSTNIT00000012913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVQAAENDGILKKMEADHLNDSLGNPGLISPDKEDLSRLLTVPFSGRIRGGMRPGKKII
VMGIVDLEPDSFDVSLTCGRASEKEEPLQDVALKLTARFSDRQFLRSARVSGKWVGEEAS
TAYFPFIPDQPFRIEIHCEHQRFRIFVDGHQLFDFYHKVKTLTSIDTVRIQGDLQITKLG
Download sequence
Identical sequences H3CWT7
ENSTNIP00000012721 99883.ENSTNIP00000012721 ENSTNIP00000012721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]