SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012735 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012735
Domain Number 1 Region: 141-247
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-21
Family Cadherin 0.00031
Further Details:      
 
Domain Number 2 Region: 365-470
Classification Level Classification E-value
Superfamily Cadherin-like 3.93e-17
Family Cadherin 0.0055
Further Details:      
 
Domain Number 3 Region: 249-363
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000186
Family Cadherin 0.0032
Further Details:      
 
Domain Number 4 Region: 463-562
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000209
Family Cadherin 0.0045
Further Details:      
 
Domain Number 5 Region: 75-148
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000002
Family Cadherin 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012735   Gene: ENSTNIG00000009846   Transcript: ENSTNIT00000012927
Sequence length 773
Comment pep:known_by_projection chromosome:TETRAODON8:17:9751114:9764959:1 gene:ENSTNIG00000009846 transcript:ENSTNIT00000012927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLLAAMAISPAVTNVSGLLVVEEENTVPVRTTRRETQPLLSRQKRDWIWNSLYVEEEKP
APTAYKIGQLKSSKNLEGKRFVIEGEGANTIFIVDHKGDLFVTRALDREEKSSYHLTARM
YDGNRNLVEDSGDFVVQVTDINDNSPVFAGTFNGSITERSMIGTKVVEVNATDADDSSTA
NGELRYSLIQDHSAFEIDSVTGVISCKINTLDRETRSQYVVVVKAQDLRGLTSGSTATTS
VTITITDTNDNIASFIRRSYELQVPENHKVNEKIGVLELEDRDQLQNKEPTFIIPNDISR
VFGIELSPNKNGNLMLRKALDYETTNSYTFSIQVRENLKNLAFPADNVNSAVTTAQVNVK
VLDVDEPPVFSQLIYSFTVEEERLASNFGTISARDPDRVNKGVRYSILDKDCPIGINPIT
GQLSTLRKLDRELEATHVFQVKAQEEPSGLESFVKVNVTVKDINDNKPELVVDEVSVCES
DVAGTVLGILRATDKDDQPASFTFSLASETSNFSIQDYGNNTAAIIVKMGPFSLDDPKDY
SVDVRISDGGRPVQTSITKLAIKSCQCDARRIPTLCKAGARRMGVSVHALLAILLCIFTI
LVIVILFVMRKRYQKDSLANMKNSGEIHEQLVTYDEEGGGEMDTNGYDVSILSSACHDGS
LLRHPDHHPHPSLYAMVQKPAHQSQPSACKGDMAVMIEMKKDEADHDRDGFPYDTLHIYG
YEGPESLAGSLSSLESSSTGSNLDYDFVSDWGPRFRTLAELYGVNEPEYYHQY
Download sequence
Identical sequences H3CWV1
ENSTNIP00000012735 ENSTNIP00000012735 99883.ENSTNIP00000012735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]