SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012757 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012757
Domain Number 1 Region: 237-525
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 8.11e-36
Family Galactose oxidase, central domain 0.018
Further Details:      
 
Domain Number 2 Region: 27-149
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-20
Family Spermadhesin, CUB domain 0.002
Further Details:      
 
Domain Number 3 Region: 690-799
Classification Level Classification E-value
Superfamily C-type lectin-like 9.66e-17
Family C-type lectin domain 0.0037
Further Details:      
 
Domain Number 4 Region: 941-987
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012757   Gene: ENSTNIG00000009868   Transcript: ENSTNIT00000012949
Sequence length 1190
Comment pep:known_by_projection chromosome:TETRAODON8:17:9095473:9152032:-1 gene:ENSTNIG00000009868 transcript:ENSTNIT00000012949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSCEKSCFSGTCTNGTCECEYGWGDQCQHCQGRFKLTDLSGSLTDGPVNYKYKTKCTWLI
EGYPNAVLRLRFNHFATECSWDHMYVYDGDSIYSPLIAVFSGLIVPESRSNDTVPEVVTT
SGYALLHFFSDAAYNLTGFNVAYSINSCPNNCSGHGRCSPANSASGRVYCECDSYWKGES
CNIPYCKNDCGSPDHGYCDLTGEKLCVCNDSWQGPDCSLSVPSTEAFWVLPSVKPSAQSS
GRASHQALVHSGLMWVVGGYSFNYSNYHMVLNYNFDTSTWDAVPTSSGPTYRYGHSLTLY
QDDIFMFGGKLEVKSANVTHELWVFNIPGRTWSLRTPALPPPYALEGHTAHVVALADGEA
AMLTFFGYSPLYSYVNKVQEYNIRSNTWQVVSAGGAVVQGGYGHSSVYDQASGCVFVHGG
YKALGSNKYGLVDHMYRYHVHTKTCGYWQRAASARYLHSAALLSGTVLIFGGNTHNDTSQ
SHGAKCFSADFLAYDIACDKWTILPRPGLHRDANRFGHSAVVSNGWTLHILHCTSAVCAG
SLSLFTELPSSCNSWATDSFSTHANFPARCVTFCQFWSIVNHFCPTDSSEEQCFRFSDCA
SCTANTRSCQWCEDRKCISASSNCTVKSVADSSRCKRREEQECFRLASCRSCSLNSNCQW
EPQQQECQAMPGQLLGRAGTIGGGCLRINNTQHYCKNLGGNIASLLTDKQVNFVLEELQK
YHLQEKRLSPWVGLRKINVSYWAWEDTSPFTNTSLRWLPGEPSDSGFCAYLERAQVAGLK
ANPCTSTTDGLICEKPIGPKSPSARPCKTPCSLRTSCANCTSQPTECMWCSSTQRCVDSS
AYVISFPYGQCLEWQTKDCTAQNCSGLRTCAECLERAECGWCGDPTNTGKGICVEGSYRG
PMKTAAARAGQRVRDKDMLLDQSLCSSDRGYNWAFIQCPACQCNGHSRCVNGSVCEHCGN
LTSGTHCQNCMPGYYGDPINGGKCNACKCNNHANVCQSNTGKCFCTTKGIKGDHCQLCDS
ENRYLGNPLRGTCYYNLLIDYQFTFSLLQEDDRHYTAINFMATPEQANKNLDMSINASNN
FNLNITWSFSSTAGTISGEEMPIIARTNIKEHRDSFSCEKFNFRLHHNITFYVYVTNFSW
PIKIQIAFSQHNSIMDLVQFFVTFFSCFLSLLLVAAVVWKVKQTCWASRR
Download sequence
Identical sequences H3CWX2
ENSTNIP00000012757 99883.ENSTNIP00000012757 ENSTNIP00000012757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]