SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012805 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012805
Domain Number 1 Region: 114-365
Classification Level Classification E-value
Superfamily L domain-like 3.74e-40
Family Ngr ectodomain-like 0.0027
Further Details:      
 
Domain Number 2 Region: 418-720
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.87e-38
Family Rhodopsin-like 0.00081
Further Details:      
 
Domain Number 3 Region: 44-81
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012805   Gene: ENSTNIG00000009913   Transcript: ENSTNIT00000012997
Sequence length 739
Comment pep:known_by_projection chromosome:TETRAODON8:7:3125926:3138499:1 gene:ENSTNIG00000009913 transcript:ENSTNIT00000012997 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVVIISFTHRHNLNLISTFYFLCFLNKVLKFDFTVLQASRVREGVCPLGQFPCGNTSECL
PQVLQCNGHRDCPNGADERRCGDNAGWADLFGQLLQNHHPVDQDPLNDCFLQDYPESCGC
VQTDVACIQVDLQDVPLLSPNVTWLSLRSNKIQVLSDFVFAEYPLLERLFLQNNSLHLIS
QHAFSGLRILKRLFLSENLISSLSPGVFKDLHQLQWLWLLDHNPLRFLSQETFIGLQSLK
YLSMVDTSLQQLPHHSFCQHMPALDWLDLEGNQIQTLNYSILKTCSKLEVLLLMNNRIQR
IPENTFHSLWKLAELNLSSNRIKELPKNIFKTLSKSLLKLNISYNPLLRIHPSHFTHLIH
LQSLWALEGIEIPEIETKMFLPMKNLSHIYFKTFQYCSYAPHVRSCKPNTDGISSFEDLL
ANMVLRVSVWVIAFITCFGNLLVIFMRSLIRAENNLHAVCIKVLCCADCLMGVYLFFVGV
FDVKFRGEYNRHALLWMESVECRTIGFLAMLSSEVSVLLLTYLTLEKFLVIVFPFSNLRP
GKLLTGVVLASIWLLGVIIAAVPLMNEGVFGNYYGHNGVCFPLHSDRQEKPTAKGYSTGV
FLGLNLVAFLIIVLSYSSMFYSIYKTGINATDLRSRLHRDVAVANRFFFIVFSDALCWIP
IFLVKILSLLEVEIPGTISSWVVIFILPINSALNPILYTLTTSFFREQVEVLLCRWQRRQ
VLKKDGKSLTSSALFVDTS
Download sequence
Identical sequences H3CX20
99883.ENSTNIP00000012805 ENSTNIP00000012805 ENSTNIP00000012805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]