SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012823 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012823
Domain Number 1 Region: 53-166
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000151
Family Ankyrin repeat 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012823   Gene: ENSTNIG00000009931   Transcript: ENSTNIT00000013015
Sequence length 791
Comment pep:known_by_projection chromosome:TETRAODON8:7:3432468:3443049:-1 gene:ENSTNIG00000009931 transcript:ENSTNIT00000013015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQLYYRRTDSSSYRDRIPLRIVRAESELSPLEKAYLGAVEKDYASVKQALEEAEIYFKI
NINCIDPLGRTALLIGIENENLEIIELLLSFGVYVGDALLHAIRKEVVGAVELLLNHKKP
SGGMQVPPILLDKQFSDFTPDITPIILAAHTNNYEIIKLLVQKGVSMPQPHEVRCNCVEC
VSSSDVDSLRHSRSRLNIYKALSSPSLIALSSEDPFLTAFRLSWELQELSKVENEFKSEY
EELSHQCKQFAKDLLDQTRSSRELEMILNYRDDINLLDEEGNNDLARLKLAIKYHQKEFV
AQPNCQQLLASRWYDEFPGWRRRHWAGKFFTCVFIGLLYPLFTLCYLVAPKSRYGLFIRK
PFIKFICHTASYLTFLFLLLLASQHIVTTEQDRQGPAPTTVEWMILPWVLGFIWAEIKQM
WDGGFQDYVHDWWNLMDFVMNSLYLATISLKIVAYTKYNGSKPRNQWEMWHPTLVAEAVF
AIAKIFSSLRLISLFTANSHLGPLQISLGRMLLDILKFLFIYCLVLLAFANGLNQLYFYY
ETKAEKGKCKGIRCVEQNNAFSTLFETLQSLFWSIFGLINLYVTNVDANHQFTEFVGATM
FGTYNIISLVVLLNMLIAMMNNSYQHIADHADIEWKFARTKLWMSYFEEGATLPPPFNII
PSPKSFWYLMCWIKEQVCKRTRSKRPESIRTLGRRAAENLRINHQYQEVLRNLVKRYVAA
MIRDAKTEEGLTEENFKELKQDISSFRYEVMGMMKTGKPALPGGKAGGGSADCSASPEDP
PGPRGSQGKSK
Download sequence
Identical sequences H3CX38
ENSTNIP00000012823 99883.ENSTNIP00000012823 ENSTNIP00000012823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]