SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012826 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012826
Domain Number 1 Region: 289-461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.82e-51
Family SPRY domain 0.0000826
Further Details:      
 
Domain Number 2 Region: 2-72
Classification Level Classification E-value
Superfamily RING/U-box 5.52e-21
Family RING finger domain, C3HC4 0.015
Further Details:      
 
Domain Number 3 Region: 92-146
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000139
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012826   Gene: ENSTNIG00000009934   Transcript: ENSTNIT00000013018
Sequence length 471
Comment pep:known_by_projection chromosome:TETRAODON8:7:3514412:3517205:1 gene:ENSTNIG00000009934 transcript:ENSTNIT00000013018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EELRNELTCAICLDYFDDPVILKCGHSFCRFCICLHWDENGDDYGYQCPQCRSVFNKKSY
TKNYLVQSLIAKLDDLDSVDAGSQHPKAVNAHGKCDKHGEELKFYCQTDKRPICAVCCES
RAHRHHDIAPTSEVMNEMKMEMEMKLMELNWQKSRYMKTVTADECTRSESKKQSLKEKIE
ADVGALVQFLLDERDSLLESLDAEEVAAMAVIEDNLKRVETHVKDVDKAIADINKHMSGK
TSFEFQQNLSEAFKEMVHVKPFSPVERVNCQTVFLDVAGPFQLIMWKKMMHVLHTMPQNL
TLDPDTAHPYLFISDCDTQVEEGHIRNQDLPDLPARFTRFCGVLATAQYSSGQHYWEVDV
KDKGVWYLGVTTVSSNRKGYVSLTPSEGYWSICLQDRLYANGEHGRIPIADYWNSPRVGV
YLDYDQGRLSFCDAVTMRRLYMFDTCFDEPVYPFFSPGKNDPGSRLKICHY
Download sequence
Identical sequences H3CX41
ENSTNIP00000012826 99883.ENSTNIP00000012826 ENSTNIP00000012826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]