SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012830 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012830
Domain Number 1 Region: 1654-1782
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-35
Family Cadherin 0.0011
Further Details:      
 
Domain Number 2 Region: 1860-1984
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-30
Family Cadherin 0.00061
Further Details:      
 
Domain Number 3 Region: 2603-2712
Classification Level Classification E-value
Superfamily Cadherin-like 1.7e-29
Family Cadherin 0.00059
Further Details:      
 
Domain Number 4 Region: 225-345
Classification Level Classification E-value
Superfamily Cadherin-like 3e-29
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 1762-1872
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-29
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 442-553
Classification Level Classification E-value
Superfamily Cadherin-like 1.28e-28
Family Cadherin 0.001
Further Details:      
 
Domain Number 7 Region: 2172-2288
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-27
Family Cadherin 0.0017
Further Details:      
 
Domain Number 8 Region: 2375-2484
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 9 Region: 1066-1207
Classification Level Classification E-value
Superfamily Cadherin-like 2.09e-26
Family Cadherin 0.0017
Further Details:      
 
Domain Number 10 Region: 554-660
Classification Level Classification E-value
Superfamily Cadherin-like 1.31e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 11 Region: 866-1007
Classification Level Classification E-value
Superfamily Cadherin-like 2.75e-24
Family Cadherin 0.0032
Further Details:      
 
Domain Number 12 Region: 1415-1541
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-24
Family Cadherin 0.00093
Further Details:      
 
Domain Number 13 Region: 1191-1299
Classification Level Classification E-value
Superfamily Cadherin-like 6.54e-23
Family Cadherin 0.0024
Further Details:      
 
Domain Number 14 Region: 2705-2808
Classification Level Classification E-value
Superfamily Cadherin-like 6.81e-22
Family Cadherin 0.0041
Further Details:      
 
Domain Number 15 Region: 2485-2601
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-22
Family Cadherin 0.0019
Further Details:      
 
Domain Number 16 Region: 1531-1658
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-21
Family Cadherin 0.0024
Further Details:      
 
Domain Number 17 Region: 656-760
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-20
Family Cadherin 0.001
Further Details:      
 
Domain Number 18 Region: 770-878
Classification Level Classification E-value
Superfamily Cadherin-like 2.86e-20
Family Cadherin 0.007
Further Details:      
 
Domain Number 19 Region: 1965-2086
Classification Level Classification E-value
Superfamily Cadherin-like 4e-19
Family Cadherin 0.0032
Further Details:      
 
Domain Number 20 Region: 118-229
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-19
Family Cadherin 0.0025
Further Details:      
 
Domain Number 21 Region: 338-446
Classification Level Classification E-value
Superfamily Cadherin-like 3.28e-18
Family Cadherin 0.0041
Further Details:      
 
Domain Number 22 Region: 2281-2379
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-16
Family Cadherin 0.002
Further Details:      
 
Domain Number 23 Region: 2805-2875
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000657
Family Cadherin 0.0025
Further Details:      
 
Domain Number 24 Region: 1351-1427
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000671
Family Cadherin 0.0052
Further Details:      
 
Domain Number 25 Region: 987-1070
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000361
Family Cadherin 0.0037
Further Details:      
 
Domain Number 26 Region: 2089-2182
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000971
Family Cadherin 0.0033
Further Details:      
 
Domain Number 27 Region: 52-125
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000275
Family Cadherin 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012830   Gene: ENSTNIG00000009938   Transcript: ENSTNIT00000013022
Sequence length 3263
Comment pep:known_by_projection chromosome:TETRAODON8:7:3572452:3621693:-1 gene:ENSTNIG00000009938 transcript:ENSTNIT00000013022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TNAVLLGTAVLIQFLSLSLFSQSTTVLGVLELQLDEGQPAGTIVGDISAGLPSGATPSLY
FISDHEGTGVGSDLNIDETTGIITTARSLDREKRDHYSFIAVTMTGVTIEVSITVNDIND
HAPEFPKKKAVLKVPEHTAIGTRFSLEPATDADKDQLTTQGYTIREGNVGQVFRLETKRA
ANKVLYLDLVISELLDREKRSSYTLVIEAFDGGSPKRIGSMTLEVTVTDINDHAPVFNQS
RYHAIISESLSQGSSILQVFATDEDEGDNGLVLYEINRRQSDPDRYFVMDVKSGVITLNR
PLDYELKRVHELVVQARDNASHPEVTNAFVTIHVRDYNDNQPTMTIIFLSEDGSPRISEG
AQPGQYVARISVTDPDYGEYANVNVSLEGGDGKFALTTKDSIIYLIYVDQELDREERDSY
DLRVMATDSGTPPLRAESSFTIQVTDVNDNPPLFDQQAYRQTIPEVVHPGSFVLQVTARD
KDQGPNGDVRYRLLKSKNSHSDWFLIDPVTGIITTATALDFESEPAPSVTVIAMDNGRPP
LSSTVKVDIVLQDVNDNTPVFSSNFYNASIKENTPAGTCFLEVSATDEDRGSFGAVTYAL
GSPSGNTPPDQFTIDKGSGQLCTSTPLDRDEGADKFDLTVTATDGGGLSSVARVRVSVVD
INDNRPAFYPVLYTVSLSTHSSPGTSVVKVTANDPDSGLNGRVTYRTVPGGGSAFFTLNK
DTGVISLSRSLHGKANTVISMEIAAEDGGGLTAPVNARVNVSVVGGSVTSPVFEQAQYFF
TVPEDVLRGTSLGVVRASAKTGEGGSKDILYSISSGDPYGYFTVDSSTGTIRTALPLDHE
TCSSLELEIQARYGFPPAYGTTRVRITISDINDNAPAFLPSSSESLLLPEITKMGTVIYT
IQATDRDSGHNGQLSFDLVSAGAAGSSGQRTFGVDRGSGEVRLIGSLSYESVPRYDLQVV
AKDGGAPQLSSTFTLVVHIQAQDARGPNFDTLTYRVELRENTPLNTQFLQLRPDGDAAGF
GIMSDSGWIFVRSSLDREVKDMYLLTVLASSGPGGAGRTGSATVRVTVTDENDNSPRLSQ
ERVFLAVRENLLAGTGFGRVSAIDRDAGLNARLTYKLLHTDRHFQINSQTAVRNLLNYVL
FKPNLLCLSSTSGEISTRLALDREHQSSYQLVVVVQDGGTPPRSATGTAHITVLDENDNA
PTFSHTRPDRELLLQVVEGLPSGTVLGTVTAKDPDEGENGTVHYSLSGARAERFTLNPMT
GELKAASPLRWAERSEYTFMVTAADHGSPGLSSTCRLQIQQIVEMKVRDGSGERPLACTR
FPLTMNAVEGAPPGSIIGSVRSQNHQQSSSTEGQVTYLVVGGSDRDGTFMVDRLKGDVYL
VRELDYEKGSRYTLHIEVSDFSQAFPSSHLVQLEINVQDRNDHAPHFTEDPVTIVIPENT
EPGASVYTFQAIDKDGSGPNSELIYSIEHYWPETHLLSLDPVSGVLTLGQKLDRESTPSL
FLVVRATDQTVDPSQRRWGSVTARMFVTDENDNTPVFSSPSAVSVMEDQPVGFVILYVMA
RDEDEGENGRVSYRIQAGNTAGRFSLNPNTDDMVRLIFQGFLLGLLSLICLRWKYRSLSI
LKALDREEQEVFNLTIVAEDHGIPQLSTSQVLSVRVIDVNDEAPVFQRAEFEALVIENKG
PGTTVLKVTAVDRDQGSNGHVTYGGVTEEGFVINPVTGVITTTKELDTEAQDHYTLTVYA
RDGGLPPNFAKALVRVEVQDVNDNAPVFARPWYRLEVPENQAPVELCSLKATDPDSGPGG
ELEYRVTAGDPDGDFHLHPSTGALSTSRGLDRETKAEYTLEVVASDRGSPALSTTVMVQV
QVMDVNDNSPIFSKSSYSVDVSEDAAEGSRVLEVSAVDADDALNGKFLYFLSQDAHGAFT
VDENTGVITTSAALDREKWAAYTFQVFAVDLSPAEPRNTSAQVTVTVLDVNDNAPVFIQD
PLVIEVSIRHSQRVLATMKAEDKDFGANGSVFYRFATPVKGFSINSLTGEIQATEPLQDL
TQAQRTLIVEAMDQGSPAQSAQGVVVIYVKEVVYNGIRFSRNARDVSIQYLKNAGTAVAQ
AQAQHPDGTQKGISYSLFSGNRKKAFIINSSTGEIMVQSSKGLDFEDTPRLRLVVKAESV
SSTSFMAINLILQDVNDNLPRFQLQNYIAYMREAQGYDMPIIQVVAEDVDQGQNGQVTYS
IQSSGMSGLFKINPVTGSITTAAIMDREIFTQTKLVVTATDRGSPRLAGSATLTVIIVDQ
NDNSPTIPLPQEVRIPENMLIGTEITLVTGNDVDSSPALSYSLQLDPTALGMFGIHRYSG
GISLTAPLDFEEKTWYTVTVRATDSQHQTEANITILIEDINDNAPTFTHDLYQVTLPEHT
PPGSTVVTVTATDRDSGENGKITYSVMSSTQDGFYIDPNNGTLFINHRAEFDPERPSVSI
VIEARDNGSPPLSSLTTVQVQISDVNDNAPVFHQSEYRATISEDTIPGSTVLTFEAFDSD
LSRENCGFDFAIANGNDGNAFQIESSVRYLEGRGFQTVGTLLLAEYLDFETKSFYNLTVV
VSDRGVPQRSSSVAAVVTIGDVNDNPPLFGRAEYSVSLSEGAAAGTEIIRLTATDPDSTP
NAEVQYTISSGDEVNLFTIDQWSGALRLQRALDREHQSTHTVIIQATDGQGHFALAPVVV
EVKDVNDNHPFFPVEVLTASIRENQPANSAVTVLHAIDHDTGVFGHLKYFMLERTGTGKE
SFSVDPNSGEIRSKIPFDFEKINSFNFVAMAIDSGNHSATVTVQVFVTGEDEYDPVFLSQ
DFSFEVPEGAKKGQSIGQVQANDEDGGVDGIVLYSFPTGSPYFDVNKTTGVIYLKLDSSS
SSSSSSSSSSSGSGRTKREARLMTLDVKAQSPLDASRTTTAQVTIDVTNTNFGLAPDVNV
LLISIIAASLGFVVLLVVMAVVVFLVKSHRKKKGQEAANRNTASGTALQKLDERNPGAGG
ERIYHQALPGYAGDQGGPGGGAYTRGGSLDPSHSSGRGSAEAAEDDEIRMINEYPRARGP
DSGIQQDADQLSDISCEPAALEGSSWFKGKKLGGSLSGTLLSGQLPVYRDEGGGYLGDGK
PSVDGSLTAIVASDEELRGSYNWDYLLNWCPQFQPLANVFTEIARLKDETAQQSQNPRQP
FQPKPKMDPKPRIDPPPLITSVAHPGAMSVPPKVPVIGRTFPHLSTLRRSPISHEGSISS
AAMSPSFSPSLSPLAARSPAVSP
Download sequence
Identical sequences H3CX45
ENSTNIP00000012830 99883.ENSTNIP00000012830 ENSTNIP00000012830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]