SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012849 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012849
Domain Number 1 Region: 172-444
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6e-48
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 7-141
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.75e-37
Family Ankyrin repeat 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012849   Gene: ENSTNIG00000009956   Transcript: ENSTNIT00000013041
Sequence length 452
Comment pep:novel chromosome:TETRAODON8:7:3924896:3929470:1 gene:ENSTNIG00000009956 transcript:ENSTNIT00000013041 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDIFTQCREGNSVAVRLWLDNTENDLNLGDDHGFSPLHWACREGRSGVVDMLIMRGARI
NVMNRGDDTPLHLAASHGHRDILAKLIQCKADPNTANEHGNTPLHYACFWGQEEVAEDLV
ASGAQVCICNRYGQTPLDKAKPHLRQLLQEKAEKMGQNMTKVPYKETFWKGTMRTRPRNG
TLNKQAGIDYKQLSLLAKINENQSGELWQGRWQGDEIIVKVLQVRDWTTRKSRDFNEEHP
KLRIFSHPNILPVLGACQSPPSPHPIIITHYMPYGSLFNILHRGTTLVVDQSQAVKFALD
IASGMAFLHTLEPMVARLYLNSKHIMIDEDLTARVSMADAKFSFQCPGRMYSPAWMAPEA
LQKKPEDINRRSADMWSFAVLLWELVTREVPFADLSHMEIGMKVALEGLRPTIPPGISPH
ICKMMRLCMNEDPAKRPKFDMIVPILEKMQDK
Download sequence
Identical sequences H3CX64
ENSTNIP00000012849 99883.ENSTNIP00000012849 ENSTNIP00000012849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]