SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000012873 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000012873
Domain Number 1 Region: 39-178
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-30
Family C-type lectin domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000012873   Gene: ENSTNIG00000009979   Transcript: ENSTNIT00000013065
Sequence length 268
Comment pep:known_by_projection chromosome:TETRAODON8:7:4382076:4384238:-1 gene:ENSTNIG00000009979 transcript:ENSTNIT00000013065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMEPCTLFFYLLCLCFDASAATSLITGQRVCRAGTGRPCYKLAYFSELKRKLNFKEADLA
CRRDGGQLLSVESAPEQKLVEQLIAELRPTDGDFWIGLRRNQAELDSSSDCSKQYYWTDG
SKSTFRNWHWDEPSCGYEVCVVMYHQPSAPPGPGPGDLYMFQWNDDNCETKNNFICKYTA
ETLAEPSPSPDSNQTSKTASVVQTFWSLSPNIIYIIIPSIPLILLLMTVTGVCCFKMLFK
RLGRRDTSLGRSEVWVAEQPRASTMGAA
Download sequence
Identical sequences H3CX88
ENSTNIP00000012873 99883.ENSTNIP00000012873 ENSTNIP00000012873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]